Details of the Target

General Information of Target

Target ID LDTP06137
Target Name Keratin, type I cuticular Ha3-II (KRT33B)
Gene Name KRT33B
Gene ID 3884
Synonyms
HHA3-II; HKA3B; KRTHA3B; Keratin, type I cuticular Ha3-II; Hair keratin, type I Ha3-II; Keratin-33B; K33B
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MPYNFCLPSLSCRTSCSSRPCVPPSCHGYTLPGACNIPANVSNCNWFCEGSFNGSEKETM
QFLNDRLASYLEKVRQLERDNAELENLIRERSQQQEPLLCPSYQSYFKTIEELQQKILCS
KSENARLVVQIDNAKLAADDFRTKYQTEQSLRQLVESDINSLRRILDELTLCRSDLEAQM
ESLKEELLSLKQNHEQEVNTLRCQLGDRLNVEVDAAPAVDLNQVLNETRNQYEALVETNR
REVEQWFATQTEELNKQVVSSSEQLQSYQAEIIELRRTVNALEIELQAQHNLRYSLENTL
TESEARYSSQLSQVQSLITNVESQLAEIRSDLERQNQEYQVLLDVRARLECEINTYRSLL
ESEDCKLPSNPCATTNACEKPIGSCVTNPCGPRSRCGPCNTFGY
Target Bioclass
Other
Family
Intermediate filament family
Uniprot ID
Q14525
Ensemble ID
ENST00000251646.8
HGNC ID
HGNC:6451

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 2 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
P2
 Probe Info  		10.00  LDD0449  [1]
DBIA
 Probe Info  		C142(3.45)  LDD3331  [2]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0022  KB02 C-4-II C142(1.56)  LDD2282  [2]
 LDCM0023  KB03 Calu-1 C142(2.21)  LDD2709  [2]
 LDCM0024  KB05 MKN-1 C142(3.45)  LDD3331  [2]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 12 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
NADH dehydrogenase flavoprotein 2, mitochondrial (NDUFV2) Complex I 24 kDa subunit family P19404
Lysine-specific histone demethylase 1A (KDM1A) Flavin monoamine oxidase family O60341
Glutathione S-transferase P (GSTP1) Pi family P09211
Nitric oxide synthase 3 (NOS3) NOS family P29474
Ubiquitin carboxyl-terminal hydrolase 2 (USP2) Peptidase C19 family O75604
Serine protease HTRA2, mitochondrial (HTRA2) Peptidase S1C family O43464
Proto-oncogene serine/threonine-protein kinase mos (MOS) Ser/Thr protein kinase family P00540
Fibroblast growth factor receptor 3 (FGFR3) Tyr protein kinase family P22607
Dual specificity protein phosphatase 21 (DUSP21) Protein-tyrosine phosphatase family Q9H596
Ribose-phosphate pyrophosphokinase 1 (PRPS1) Ribose-phosphate pyrophosphokinase family P60891
Ras-related protein Rab-26 (RAB26) Rab family Q9ULW5
GTPase HRas (HRAS) Ras family P01112
Transporter and channel
Click To Hide/Show 8 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Metal transporter CNNM3 (CNNM3) ACDP family Q8NE01
Cytochrome c oxidase subunit 5B, mitochondrial (COX5B) Cytochrome c oxidase subunit 5B family P10606
Huntingtin (HTT) Huntingtin family P42858
Aquaporin-1 (AQP1) MIP/aquaporin (TC 1.A.8) family P29972
Nucleoporin p54 (NUP54) NUP54 family Q7Z3B4
Nucleoporin p58/p45 (NUP58) NUP58 family Q9BVL2
Sodium channel modifier 1 (SCNM1) . Q9BWG6
Wolframin (WFS1) . O76024
Transcription factor
Click To Hide/Show 2 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Homeobox protein Hox-A1 (HOXA1) Antp homeobox family P49639
Krueppel-like factor 11 (KLF11) Sp1 C2H2-type zinc-finger protein family O14901
Immunoglobulin
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Hyaluronan and proteoglycan link protein 2 (HAPLN2) HAPLN family Q9GZV7
Cytokine and receptor
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Tumor necrosis factor ligand superfamily member 6 (FASLG) Tumor necrosis factor family P48023
Other
Click To Hide/Show 42 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Abl interactor 2 (ABI2) ABI family Q9NYB9
Cysteine-rich tail protein 1 (CYSRT1) CYSRT1 family A8MQ03
Protein INCA1 (INCA1) INCA family Q0VD86
Desmin (DES) Intermediate filament family P17661
Glial fibrillary acidic protein (GFAP) Intermediate filament family P14136
Keratin, type II cuticular Hb2 (KRT82) Intermediate filament family Q9NSB4
Keratin, type II cuticular Hb3 (KRT83) Intermediate filament family P78385
Keratin, type II cuticular Hb5 (KRT85) Intermediate filament family P78386
Keratin, type II cuticular Hb6 (KRT86) Intermediate filament family O43790
Keratin, type II cytoskeletal 1 (KRT1) Intermediate filament family P04264
Keratin, type II cytoskeletal 2 epidermal (KRT2) Intermediate filament family P35908
Keratin, type II cytoskeletal 3 (KRT3) Intermediate filament family P12035
Keratin, type II cytoskeletal 4 (KRT4) Intermediate filament family P19013
Keratin, type II cytoskeletal 6B (KRT6B) Intermediate filament family P04259
Keratin, type II cytoskeletal 6C (KRT6C) Intermediate filament family P48668
Keratin, type II cytoskeletal 71 (KRT71) Intermediate filament family Q3SY84
Keratin, type II cytoskeletal 72 (KRT72) Intermediate filament family Q14CN4
Keratin, type II cytoskeletal 75 (KRT75) Intermediate filament family O95678
Keratin, type II cytoskeletal 78 (KRT78) Intermediate filament family Q8N1N4
Keratin, type II cytoskeletal 79 (KRT79) Intermediate filament family Q5XKE5
Keratin, type II cytoskeletal 8 (KRT8) Intermediate filament family P05787
Neurofilament light polypeptide (NEFL) Intermediate filament family P07196
Peripherin (PRPH) Intermediate filament family P41219
Kinesin light chain 4 (KLC4) Kinesin light chain family Q9NSK0
RNA guanine-N7 methyltransferase activating subunit (RAMAC) RAM family Q9BTL3
SAGA-associated factor 29 (SGF29) SGF29 family Q96ES7
T-complex protein 1 subunit epsilon (CCT5) TCP-1 chaperonin family P48643
UPF0500 protein C1orf216 (C1orf216) UPF0500 family Q8TAB5
Gelsolin (GSN) Villin/gelsolin family P06396
Vacuolar protein sorting-associated protein 37C (VPS37C) VPS37 family A5D8V6
Aminoacyl tRNA synthase complex-interacting multifunctional protein 2 (AIMP2) . Q13155
Arfaptin-1 (ARFIP1) . P53367
Coiled-coil domain-containing protein 24 (CCDC24) . Q8N4L8
Fibroblast growth factor receptor substrate 3 (FRS3) . O43559
Hepatocyte growth factor-regulated tyrosine kinase substrate (HGS) . O14964
LIM domain transcription factor LMO4 (LMO4) . P61968
Merlin (NF2) . P35240
Phostensin (PPP1R18) . Q6NYC8
Receptor-transporting protein 5 (RTP5) . Q14D33
RING finger protein 11 (RNF11) . Q9Y3C5
SHC-transforming protein 3 (SHC3) . Q92529
Sprouty-related, EVH1 domain-containing protein 1 (SPRED1) . Q7Z699

References

1 Comparison of Different Competitive Proteome Profiling Approaches in Target Identification of Covalent Inhibitors. Chembiochem. 2022 Dec 16;23(24):e202200389. doi: 10.1002/cbic.202200389. Epub 2022 Nov 22.
2 DrugMap: A quantitative pan-cancer analysis of cysteine ligandability. Cell. 2024 May 9;187(10):2536-2556.e30. doi: 10.1016/j.cell.2024.03.027. Epub 2024 Apr 22.
Mass spectrometry data entry: PXD047840