Details of the Target
General Information of Target
| Target ID | LDTP06086 | |||||
|---|---|---|---|---|---|---|
| Target Name | Lymphocyte antigen 6D (LY6D) | |||||
| Gene Name | LY6D | |||||
| Gene ID | 8581 | |||||
| Synonyms |
E48; Lymphocyte antigen 6D; Ly-6D; E48 antigen |
|||||
| 3D Structure | ||||||
| Sequence |
MRTALLLLAALAVATGPALTLRCHVCTSSSNCKHSVVCPASSRFCKTTNTVEPLRGNLVK
KDCAESCTPSYTLQGQVSSGTSSTQCCQEDLCNEKLHNAAPTRTALAHSALSLGLALSLL AVILAPSL |
|||||
| Target Type |
Literature-reported
|
|||||
| Target Bioclass |
Other
|
|||||
| Subcellular location |
Cell membrane
|
|||||
| Function | May act as a specification marker at earliest stage specification of lymphocytes between B- and T-cell development. Marks the earliest stage of B-cell specification. | |||||
| TTD ID | ||||||
| Uniprot ID | ||||||
| DrugMap ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
OPA-S-S-alkyne Probe Info |
 |
K46(1.33) | LDD3494 | [1] | |
|
AF-1 Probe Info |
 |
10.00 | LDD0421 | [2] | |
|
AF-2 Probe Info |
 |
10.00 | LDD0422 | [2] | |
|
DBIA Probe Info |
 |
C38(1.66) | LDD2418 | [3] | |
Competitor(s) Related to This Target
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Enzyme
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Very long chain fatty acid elongase 4 (ELOVL4) | ELO family | Q9GZR5 | |||
| Lysoplasmalogenase TMEM86B (TMEM86B) | TMEM86 family | Q8N661 | |||
Transporter and channel
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Aquaporin-6 (AQP6) | MIP/aquaporin (TC 1.A.8) family | Q13520 | |||
References