Details of the Target
General Information of Target
| Target ID | LDTP06004 | |||||
|---|---|---|---|---|---|---|
| Target Name | Nuclear nucleic acid-binding protein C1D (C1D) | |||||
| Gene Name | C1D | |||||
| Gene ID | 10438 | |||||
| Synonyms |
Nuclear nucleic acid-binding protein C1D; hC1D |
|||||
| 3D Structure | ||||||
| Sequence |
MAGEEINEDYPVEIHEYLSAFENSIGAVDEMLKTMMSVSRNELLQKLDPLEQAKVDLVSA
YTLNSMFWVYLATQGVNPKEHPVKQELERIRVYMNRVKEITDKKKAGKLDRGAASRFVKN ALWEPKSKNASKVANKGKSKS |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
C1D family
|
|||||
| Subcellular location |
Nucleus
|
|||||
| Function |
Plays a role in the recruitment of the RNA exosome complex to pre-rRNA to mediate the 3'-5' end processing of the 5.8S rRNA; this function may include MPHOSPH6. Can activate PRKDC not only in the presence of linear DNA but also in the presence of supercoiled DNA. Can induce apoptosis in a p53/TP53 dependent manner. May regulate the TRAX/TSN complex formation. Potentiates transcriptional repression by NR1D1 and THRB.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
STPyne Probe Info |
 |
K119(10.00); K98(10.00) | LDD0277 | [1] | |
PAL-AfBPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
C232 Probe Info |
 |
60.97 | LDD1905 | [2] | |
|
C313 Probe Info |
 |
30.70 | LDD1980 | [2] | |
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Enzyme
Transporter and channel
Transcription factor
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Homeobox protein goosecoid-2 (GSC2) | Paired homeobox family | O15499 | |||
Cytokine and receptor
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Interleukin-23 receptor (IL23R) | Type I cytokine receptor family | Q5VWK5 | |||
References