General Information of Target

Target ID LDTP05996
Target Name Protein-tyrosine kinase 6 (PTK6)
Gene Name PTK6
Gene ID 5753
Synonyms
BRK; Protein-tyrosine kinase 6; EC 2.7.10.2; Breast tumor kinase; Tyrosine-protein kinase BRK
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MVSRDQAHLGPKYVGLWDFKSRTDEELSFRAGDVFHVARKEEQWWWATLLDEAGGAVAQG
YVPHNYLAERETVESEPWFFGCISRSEAVRRLQAEGNATGAFLIRVSEKPSADYVLSVRD
TQAVRHYKIWRRAGGRLHLNEAVSFLSLPELVNYHRAQSLSHGLRLAAPCRKHEPEPLPH
WDDWERPREEFTLCRKLGSGYFGEVFEGLWKDRVQVAIKVISRDNLLHQQMLQSEIQAMK
KLRHKHILALYAVVSVGDPVYIITELMAKGSLLELLRDSDEKVLPVSELLDIAWQVAEGM
CYLESQNYIHRDLAARNILVGENTLCKVGDFGLARLIKEDVYLSHDHNIPYKWTAPEALS
RGHYSTKSDVWSFGILLHEMFSRGQVPYPGMSNHEAFLRVDAGYRMPCPLECPPSVHKLM
LTCWCRDPEQRPCFKALRERLSSFTSYENPT
Target Type
Clinical trial
Target Bioclass
Enzyme
Family
Protein kinase superfamily, Tyr protein kinase family, BRK/PTK6/SIK subfamily
Subcellular location
Cytoplasm
Function
Non-receptor tyrosine-protein kinase implicated in the regulation of a variety of signaling pathways that control the differentiation and maintenance of normal epithelia, as well as tumor growth. Function seems to be context dependent and differ depending on cell type, as well as its intracellular localization. A number of potential nuclear and cytoplasmic substrates have been identified. These include the RNA-binding proteins: KHDRBS1/SAM68, KHDRBS2/SLM1, KHDRBS3/SLM2 and SFPQ/PSF; transcription factors: STAT3 and STAT5A/B and a variety of signaling molecules: ARHGAP35/p190RhoGAP, PXN/paxillin, BTK/ATK, STAP2/BKS. Associates also with a variety of proteins that are likely upstream of PTK6 in various signaling pathways, or for which PTK6 may play an adapter-like role. These proteins include ADAM15, EGFR, ERBB2, ERBB3 and IRS4. In normal or non-tumorigenic tissues, PTK6 promotes cellular differentiation and apoptosis. In tumors PTK6 contributes to cancer progression by sensitizing cells to mitogenic signals and enhancing proliferation, anchorage-independent survival and migration/invasion. Association with EGFR, ERBB2, ERBB3 may contribute to mammary tumor development and growth through enhancement of EGF-induced signaling via BTK/AKT and PI3 kinase. Contributes to migration and proliferation by contributing to EGF-mediated phosphorylation of ARHGAP35/p190RhoGAP, which promotes association with RASA1/p120RasGAP, inactivating RhoA while activating RAS. EGF stimulation resulted in phosphorylation of PNX/Paxillin by PTK6 and activation of RAC1 via CRK/CrKII, thereby promoting migration and invasion. PTK6 activates STAT3 and STAT5B to promote proliferation. Nuclear PTK6 may be important for regulating growth in normal epithelia, while cytoplasmic PTK6 might activate oncogenic signaling pathways.; Isoform 2 inhibits PTK6 phosphorylation and PTK6 association with other tyrosine-phosphorylated proteins.
TTD ID
T73694
Uniprot ID
Q13882
DrugMap ID
TT6TH8V
Ensemble ID
ENST00000217185.3
HGNC ID
HGNC:9617
ChEMBL ID
CHEMBL4601

Target Site Mutations in Different Cell Lines

Cell line Mutation details Probe for labeling this protein in this cell
HEC1B SNV: p.A358T .
KASUMI1 SNV: p.A56G .
KMS12BM SNV: p.V106F .
TOV21G SNV: p.W17L; p.R119L .

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 4 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
STPyne
 Probe Info 
K128(10.00)  LDD0277  [1]
DBIA
 Probe Info 
C433(2.24)  LDD3389  [2]
NAIA_5
 Probe Info 
C82(0.63)  LDD2227  [3]
IA-alkyne
 Probe Info 
N.A.  LDD0162  [4]
PAL-AfBPP Probe
Click To Hide/Show 2 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
DFG-out-3
 Probe Info 
7.70  LDD0074  [5]
DFG-out-4
 Probe Info 
0.00  LDD0075  [5]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0632  CL-Sc Hep-G2 C82(0.63)  LDD2227  [3]
 LDCM0017  DFG-out-2 A431 0.00  LDD0075  [5]
 LDCM0022  KB02 ICC19 C433(2.62)  LDD2386  [2]
 LDCM0023  KB03 ICC4 C433(1.92)  LDD2809  [2]
 LDCM0024  KB05 OZ C433(2.24)  LDD3389  [2]
 LDCM0016  Ranjitkar_cp1 A431 7.70  LDD0074  [5]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 8 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Putative histone-lysine N-methyltransferase PRDM6 (PRDM6) Class V-like SAM-binding methyltransferase superfamily Q9NQX0
Probable ATP-dependent RNA helicase DDX17 (DDX17) DEAD box helicase family Q92841
Probable E3 ubiquitin-protein ligase DTX3 (DTX3) Deltex family Q8N9I9
Protein-tyrosine kinase 6 (PTK6) Tyr protein kinase family Q13882
Mast/stem cell growth factor receptor Kit (KIT) Tyr protein kinase family P10721
Receptor tyrosine-protein kinase erbB-2 (ERBB2) Tyr protein kinase family P04626
E3 ubiquitin-protein ligase CBL-B (CBLB) . Q13191
Probable E3 ubiquitin-protein ligase makorin-3 (MKRN3) . Q13064
Transporter and channel
Click To Hide/Show 4 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Hsp90 co-chaperone Cdc37 (CDC37) CDC37 family Q16543
Heat shock protein HSP 90-beta (HSP90AB1) Heat shock protein 90 family P08238
Huntingtin (HTT) Huntingtin family P42858
Exocyst complex component 5 (EXOC5) SEC10 family O00471
Transcription factor
Click To Hide/Show 5 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Zinc finger protein Aiolos (IKZF3) Ikaros C2H2-type zinc-finger protein family Q9UKT9
Zinc finger protein 341 (ZNF341) Krueppel C2H2-type zinc-finger protein family Q9BYN7
Pituitary homeobox 1 (PITX1) Paired homeobox family P78337
Proto-oncogene c-Rel (REL) . Q04864
Splicing factor, proline- and glutamine-rich (SFPQ) . P23246
Other
Click To Hide/Show 8 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Alpha-actinin-3 (ACTN3) Alpha-actinin family Q08043
F-BAR domain only protein 1 (FCHO1) FCHO family O14526
GRB2-associated-binding protein 1 (GAB1) GAB family Q13480
KH domain-containing, RNA-binding, signal transduction-associated protein 2 (KHDRBS2) KHDRBS family Q5VWX1
Myozenin-3 (MYOZ3) Myozenin family Q8TDC0
Actin nucleation-promoting factor WASL (WASL) . O00401
Ankyrin repeat domain-containing protein 55 (ANKRD55) . Q3KP44
EF-hand domain-containing family member C2 (EFHC2) . Q5JST6

The Drug(s) Related To This Target

Approved
Click To Hide/Show 4 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Fostamatinib Small molecular drug DB12010
Tivozanib Small molecular drug DB11800
Vandetanib Small molecular drug DB05294
Zanubrutinib . DB15035
Phase 1
Click To Hide/Show 1 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Isis-crp Antisense drug D06CIJ
Investigative
Click To Hide/Show 1 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Pmid21855335c19a Small molecular drug D0IZ8M

References

1 A Paal-Knorr agent for chemoproteomic profiling of targets of isoketals in cells. Chem Sci. 2021 Oct 15;12(43):14557-14563. doi: 10.1039/d1sc02230j. eCollection 2021 Nov 10.
Mass spectrometry data entry: PXD028270
2 DrugMap: A quantitative pan-cancer analysis of cysteine ligandability. Cell. 2024 May 9;187(10):2536-2556.e30. doi: 10.1016/j.cell.2024.03.027. Epub 2024 Apr 22.
Mass spectrometry data entry: PXD047840
3 N-Acryloylindole-alkyne (NAIA) enables imaging and profiling new ligandable cysteines and oxidized thiols by chemoproteomics. Nat Commun. 2023 Jun 15;14(1):3564. doi: 10.1038/s41467-023-39268-w.
Mass spectrometry data entry: PXD041264
4 SP3-FAIMS Chemoproteomics for High-Coverage Profiling of the Human Cysteinome*. Chembiochem. 2021 May 14;22(10):1841-1851. doi: 10.1002/cbic.202000870. Epub 2021 Feb 18.
Mass spectrometry data entry: PXD023056 , PXD023059 , PXD023058 , PXD023057 , PXD023060
5 Affinity-based probes based on type II kinase inhibitors. J Am Chem Soc. 2012 Nov 21;134(46):19017-25. doi: 10.1021/ja306035v. Epub 2012 Nov 6.