Details of the Target

General Information of Target

Target ID LDTP05961
Target Name Four and a half LIM domains protein 1 (FHL1)
Gene Name FHL1
Gene ID 2273
Synonyms
SLIM1; Four and a half LIM domains protein 1; FHL-1; Skeletal muscle LIM-protein 1; SLIM; SLIM-1
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MAEKFDCHYCRDPLQGKKYVQKDGHHCCLKCFDKFCANTCVECRKPIGADSKEVHYKNRF
WHDTCFRCAKCLHPLANETFVAKDNKILCNKCTTREDSPKCKGCFKAIVAGDQNVEYKGT
VWHKDCFTCSNCKQVIGTGSFFPKGEDFYCVTCHETKFAKHCVKCNKAITSGGITYQDQP
WHADCFVCVTCSKKLAGQRFTAVEDQYYCVDCYKNFVAKKCAGCKNPITGKRTVSRVSHP
VSKARKPPVCHGKRLPLTLFPSANLRGRHPGGERTCPSWVVVLYRKNRSLAAPRGPGLVK
APVWWPMKDNPGTTTASTAKNAP
Target Type
Literature-reported
Target Bioclass
Other
Subcellular location
Cytoplasm; Nucleus
Function May have an involvement in muscle development or hypertrophy.
TTD ID
T81135
Uniprot ID
Q13642
DrugMap ID
TTI7ENL
Ensemble ID
ENST00000370683.6
HGNC ID
HGNC:3702

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 19 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
m-APA
 Probe Info  		10.80  LDD0402  [1]
Probe 1
 Probe Info  		Y117(61.11)  LDD3495  [2]
P11
 Probe Info  		12.72  LDD0201  [3]
DBIA
 Probe Info  		C87(0.86)  LDD3311  [4]
HHS-465
 Probe Info  		Y149(10.00); Y207(10.00); Y9(10.00)  LDD2237  [5]
ATP probe
 Probe Info  		K86(0.00); K157(0.00); K160(0.00); K91(0.00)  LDD0199  [6]
4-Iodoacetamidophenylacetylene
 Probe Info  		C71(0.00); C65(0.00)  LDD0038  [7]
IA-alkyne
 Probe Info  		C71(0.00); C92(0.00); C150(0.00)  LDD0032  [8]
Lodoacetamide azide
 Probe Info  		C71(0.00); C7(0.00); C10(0.00); C65(0.00)  LDD0037  [7]
WYneN
 Probe Info  		N.A.  LDD0021  [9]
IPM
 Probe Info  		C7(0.00); C71(0.00); C36(0.00); C27(0.00)  LDD0005  [9]
SF
 Probe Info  		N.A.  LDD0028  [10]
STPyne
 Probe Info  		K83(0.00); K160(0.00); K157(0.00)  LDD0009  [9]
Phosphinate-6
 Probe Info  		C89(0.00); C92(0.00)  LDD0018  [11]
Ox-W18
 Probe Info  		N.A.  LDD2175  [12]
1d-yne
 Probe Info  		N.A.  LDD0357  [13]
Acrolein
 Probe Info  		C36(0.00); C65(0.00); H154(0.00)  LDD0217  [14]
Methacrolein
 Probe Info  		N.A.  LDD0218  [14]
AOyne
 Probe Info  		9.90  LDD0443  [15]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0026  4SU-RNA+native RNA HEK-293T C7(3.02); C65(2.54)  LDD0372  [16]
 LDCM0156  Aniline NCI-H1299 N.A.  LDD0405  [1]
 LDCM0020  ARS-1620 HCC44 C10(1.21); C7(1.21); C209(1.05); C212(1.05)  LDD2171  [17]
 LDCM0088  C45 HEK-293T 12.72  LDD0201  [3]
 LDCM0108  Chloroacetamide HeLa C65(0.00); H154(0.00); C132(0.00); C10(0.00)  LDD0222  [14]
 LDCM0213  Electrophilic fragment 2 MDA-MB-231 C71(0.71)  LDD1702  [18]
 LDCM0107  IAA HeLa N.A.  LDD0221  [14]
 LDCM0022  KB02 42-MG-BA C87(1.32); C94(1.55)  LDD2244  [4]
 LDCM0023  KB03 Jurkat C150(4.49)  LDD0315  [8]
 LDCM0024  KB05 G361 C87(0.86)  LDD3311  [4]
 LDCM0109  NEM HeLa H62(0.00); H73(0.00)  LDD0223  [14]
 LDCM0627  NUDT7-COV-1 HEK-293T C150(1.24); C71(1.13)  LDD2206  [19]
 LDCM0628  OTUB2-COV-1 HEK-293T C71(1.07); C150(1.04); C71(0.60)  LDD2207  [19]
 LDCM0131  RA190 MM1.R C132(1.35); C71(1.15); C188(1.03); C191(1.03)  LDD0304  [20]
 LDCM0021  THZ1 HCT 116 C10(1.21); C7(1.21); C209(1.05); C212(1.05)  LDD2173  [17]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform (PPP2CB) PPP phosphatase family P62714
Transporter and channel
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Major prion protein (PRNP) Prion family P04156
Other
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Nuclear receptor-interacting protein 1 (NRIP1) . P48552

References

1 Quantitative and Site-Specific Chemoproteomic Profiling of Targets of Acrolein. Chem Res Toxicol. 2019 Mar 18;32(3):467-473. doi: 10.1021/acs.chemrestox.8b00343. Epub 2019 Jan 15.
2 An Azo Coupling-Based Chemoproteomic Approach to Systematically Profile the Tyrosine Reactivity in the Human Proteome. Anal Chem. 2021 Jul 27;93(29):10334-10342. doi: 10.1021/acs.analchem.1c01935. Epub 2021 Jul 12.
3 Discovery of Potent and Selective Inhibitors against Protein-Derived Electrophilic Cofactors. J Am Chem Soc. 2022 Mar 30;144(12):5377-5388. doi: 10.1021/jacs.1c12748. Epub 2022 Mar 2.
4 DrugMap: A quantitative pan-cancer analysis of cysteine ligandability. Cell. 2024 May 9;187(10):2536-2556.e30. doi: 10.1016/j.cell.2024.03.027. Epub 2024 Apr 22.
Mass spectrometry data entry: PXD047840
5 Global targeting of functional tyrosines using sulfur-triazole exchange chemistry. Nat Chem Biol. 2020 Feb;16(2):150-159. doi: 10.1038/s41589-019-0404-5. Epub 2019 Nov 25.
6 Targeted Proteomic Approaches for Proteome-Wide Characterizations of the AMP-Binding Capacities of Kinases. J Proteome Res. 2022 Aug 5;21(8):2063-2070. doi: 10.1021/acs.jproteome.2c00225. Epub 2022 Jul 12.
7 Enhancing Cysteine Chemoproteomic Coverage through Systematic Assessment of Click Chemistry Product Fragmentation. Anal Chem. 2022 Mar 8;94(9):3800-3810. doi: 10.1021/acs.analchem.1c04402. Epub 2022 Feb 23.
Mass spectrometry data entry: PXD028853
8 SP3-FAIMS Chemoproteomics for High-Coverage Profiling of the Human Cysteinome*. Chembiochem. 2021 May 14;22(10):1841-1851. doi: 10.1002/cbic.202000870. Epub 2021 Feb 18.
Mass spectrometry data entry: PXD023056 , PXD023059 , PXD023058 , PXD023057 , PXD023060
9 A modification-centric assessment tool for the performance of chemoproteomic probes. Nat Chem Biol. 2022 Aug;18(8):904-912. doi: 10.1038/s41589-022-01074-8. Epub 2022 Jul 21.
Mass spectrometry data entry: PXD027758 , PXD027755 , PXD027760 , PXD027762 , PXD027756 , PXD027591 , PXD007149 , PXD030064 , PXD032392 , PXD027789 , PXD027767 , PXD027764
10 Solid Phase Synthesis of Fluorosulfate Containing Macrocycles for Chemoproteomic Workflows. bioRxiv [Preprint]. 2023 Feb 18:2023.02.17.529022. doi: 10.1101/2023.02.17.529022.
Mass spectrometry data entry: PXD039931
11 DFT-Guided Discovery of Ethynyl-Triazolyl-Phosphinates as Modular Electrophiles for Chemoselective Cysteine Bioconjugation and Profiling. Angew Chem Int Ed Engl. 2022 Oct 10;61(41):e202205348. doi: 10.1002/anie.202205348. Epub 2022 Aug 22.
Mass spectrometry data entry: PXD033004
12 Oxidative cyclization reagents reveal tryptophan cation- interactions. Nature. 2024 Mar;627(8004):680-687. doi: 10.1038/s41586-024-07140-6. Epub 2024 Mar 6.
Mass spectrometry data entry: PXD001377 , PXD005252
13 Tunable Amine-Reactive Electrophiles for Selective Profiling of Lysine. Angew Chem Int Ed Engl. 2022 Jan 26;61(5):e202112107. doi: 10.1002/anie.202112107. Epub 2021 Dec 16.
14 ACR-Based Probe for the Quantitative Profiling of Histidine Reactivity in the Human Proteome. J Am Chem Soc. 2023 Mar 8;145(9):5252-5260. doi: 10.1021/jacs.2c12653. Epub 2023 Feb 27.
15 Chemoproteomic profiling of targets of lipid-derived electrophiles by bioorthogonal aminooxy probe. Redox Biol. 2017 Aug;12:712-718. doi: 10.1016/j.redox.2017.04.001. Epub 2017 Apr 5.
16 Chemoproteomic capture of RNA binding activity in living cells. Nat Commun. 2023 Oct 7;14(1):6282. doi: 10.1038/s41467-023-41844-z.
Mass spectrometry data entry: PXD044625
17 Reimagining high-throughput profiling of reactive cysteines for cell-based screening of large electrophile libraries. Nat Biotechnol. 2021 May;39(5):630-641. doi: 10.1038/s41587-020-00778-3. Epub 2021 Jan 4.
18 Nucleophilic covalent ligand discovery for the cysteine redoxome. Nat Chem Biol. 2023 Nov;19(11):1309-1319. doi: 10.1038/s41589-023-01330-5. Epub 2023 May 29.
Mass spectrometry data entry: PXD039908 , PXD029761
19 Rapid Covalent-Probe Discovery by Electrophile-Fragment Screening. J Am Chem Soc. 2019 Jun 5;141(22):8951-8968. doi: 10.1021/jacs.9b02822. Epub 2019 May 22.
20 Physical and Functional Analysis of the Putative Rpn13 Inhibitor RA190. Cell Chem Biol. 2020 Nov 19;27(11):1371-1382.e6. doi: 10.1016/j.chembiol.2020.08.007. Epub 2020 Aug 27.