Details of the Target

General Information of Target

Target ID LDTP05861
Target Name DNA-binding protein Ikaros (IKZF1)
Gene Name IKZF1
Gene ID 10320
Synonyms
IK1; IKAROS; LYF1; ZNFN1A1; DNA-binding protein Ikaros; Ikaros family zinc finger protein 1; Lymphoid transcription factor LyF-1
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MDADEGQDMSQVSGKESPPVSDTPDEGDEPMPIPEDLSTTSGGQQSSKSDRVVASNVKVE
TQSDEENGRACEMNGEECAEDLRMLDASGEKMNGSHRDQGSSALSGVGGIRLPNGKLKCD
ICGIICIGPNVLMVHKRSHTGERPFQCNQCGASFTQKGNLLRHIKLHSGEKPFKCHLCNY
ACRRRDALTGHLRTHSVGKPHKCGYCGRSYKQRSSLEEHKERCHNYLESMGLPGTLYPVI
KEETNHSEMAEDLCKIGSERSLVLDRLASNVAKRKSSMPQKFLGDKGLSDTPYDSSASYE
KENEMMKSHVMDQAINNAINYLGAESLRPLVQTPPGGSEVVPVISPMYQLHKPLAEGTPR
SNHSAQDSAVENLLLLSKAKLVPSEREASPSNSCQDSTDTESNNEEQRSGLIYLTNHIAP
HARNGLSLKEEHRAYDLLRAASENSQDALRVVSTSGEQMKVYKCEHCRVLFLDHVMYTIH
MGCHGFRDPFECNMCGYHSQDRYEFSSHITRGEHRFHMS
Target Bioclass
Transcription factor
Family
Ikaros C2H2-type zinc-finger protein family
Subcellular location
Nucleus
Function
Transcription regulator of hematopoietic cell differentiation. Binds gamma-satellite DNA. Plays a role in the development of lymphocytes, B- and T-cells. Binds and activates the enhancer (delta-A element) of the CD3-delta gene. Repressor of the TDT (fikzfterminal deoxynucleotidyltransferase) gene during thymocyte differentiation. Regulates transcription through association with both HDAC-dependent and HDAC-independent complexes. Targets the 2 chromatin-remodeling complexes, NuRD and BAF (SWI/SNF), in a single complex (PYR complex), to the beta-globin locus in adult erythrocytes. Increases normal apoptosis in adult erythroid cells. Confers early temporal competence to retinal progenitor cells (RPCs). Function is isoform-specific and is modulated by dominant-negative inactive isoforms.
Uniprot ID
Q13422
Ensemble ID
ENST00000331340.8
HGNC ID
HGNC:13176
ChEMBL ID
CHEMBL4739685

Target Site Mutations in Different Cell Lines

Cell line Mutation details Probe for labeling this protein in this cell
AN3CA SNV: p.S63G .
AU565 SNV: p.G106V .
COLO792 SNV: p.Y321S .
HEC1 SNV: p.M518V .
IGROV1 SNV: p.R162Q .
JURKAT SNV: p.R162W .
JURLMK1 SNV: p.K171N .
KYSE150 SNV: p.Q44H .
LN18 SNV: p.S101N .
MCC13 Substitution: p.A152T .
MFE319 SNV: p.A324G .
MOLT4 SNV: p.R386C; p.D473N IA-alkyne    Probe Info 
OCIAML5 SNV: p.D186Y .
PC9 SNV: p.M311I .
SUPT1 SNV: p.A434T .
TOV21G SNV: p.R468L .
UACC62 SNV: p.P113T .

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 4 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
DBIA
 Probe Info  		C394(12.72)  LDD0209  [1]
4-Iodoacetamidophenylacetylene
 Probe Info  		C223(0.00); C254(0.00)  LDD0038  [2]
IA-alkyne
 Probe Info  		C254(0.00); C175(0.00); C178(0.00); C182(0.00)  LDD0036  [2]
Lodoacetamide azide
 Probe Info  		C223(0.00); C254(0.00)  LDD0037  [2]
PAL-AfBPP Probe
Click To Hide/Show 1 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
pLen
 Probe Info  		6.86  LDD0254  [3]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0586  Fragment28 Ramos C394(1.08)  LDD2198  [4]
 LDCM0566  Fragment4 Ramos C394(0.40)  LDD2184  [4]
 LDCM0569  Fragment7 Ramos C394(0.64)  LDD2186  [4]
 LDCM0022  KB02 Ramos C394(0.63)  LDD2182  [4]
 LDCM0023  KB03 Jurkat C394(12.72)  LDD0209  [1]
 LDCM0024  KB05 NALM-6 C254(1.65)  LDD3339  [5]
 LDCM0114  Len MM1.S 6.86  LDD0254  [3]
 LDCM0170  Structure8 Ramos 4.38  LDD0433  [6]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 25 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
5'-AMP-activated protein kinase subunit beta-2 (PRKAB2) 5'-AMP-activated protein kinase beta subunit family O43741
Alpha-ketoglutarate-dependent dioxygenase alkB homolog 3 (ALKBH3) AlkB family Q96Q83
Glutamine--tRNA ligase (QARS1) Class-I aminoacyl-tRNA synthetase family P47897
C-terminal-binding protein 2 (CTBP2) D-isomer specific 2-hydroxyacid dehydrogenase family P56545
Probable ATP-dependent RNA helicase DDX6 (DDX6) DEAD box helicase family P26196
Bifunctional polynucleotide phosphatase/kinase (PNKP) DNA 3' phosphatase family Q96T60
Nucleoside diphosphate kinase homolog 7 (NME7) NDK family Q9Y5B8
Cleavage and polyadenylation specificity factor subunit 5 (NUDT21) Nudix hydrolase family O43809
Proteasome subunit alpha type-1 (PSMA1) Peptidase T1A family P25786
Proteasome subunit alpha type-4 (PSMA4) Peptidase T1A family P25789
5'-AMP-activated protein kinase catalytic subunit alpha-2 (PRKAA2) CAMK Ser/Thr protein kinase family P54646
Cyclin-dependent kinase-like 3 (CDKL3) CMGC Ser/Thr protein kinase family Q8IVW4
Dual specificity tyrosine-phosphorylation-regulated kinase 2 (DYRK2) CMGC Ser/Thr protein kinase family Q92630
Serine/threonine-protein kinase Nek6 (NEK6) NEK Ser/Thr protein kinase family Q9HC98
Proto-oncogene serine/threonine-protein kinase mos (MOS) Ser/Thr protein kinase family P00540
Cell division cycle 7-related protein kinase (CDC7) Ser/Thr protein kinase family O00311
Tyrosine-protein kinase TXK (TXK) Tyr protein kinase family P42681
Apoptosis-enhancing nuclease (AEN) . Q8WTP8
BRCA1-associated RING domain protein 1 (BARD1) . Q99728
E3 ubiquitin-protein ligase RNF4 (RNF4) . P78317
Germ cell-less protein-like 2 (GMCL2) . Q8NEA9
Glutaredoxin-3 (GLRX3) . O76003
Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 (PIN1) . Q13526
RWD domain-containing protein 2B (RWDD2B) . P57060
Thiosulfate sulfurtransferase/rhodanese-like domain-containing protein 2 (TSTD2) . Q5T7W7
Transporter and channel
Click To Hide/Show 3 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
AP-1 complex subunit mu-1 (AP1M1) Adaptor complexes medium subunit family Q9BXS5
Sodium channel modifier 1 (SCNM1) . Q9BWG6
Syntenin-1 (SDCBP) . O00560
Transcription factor
Click To Hide/Show 5 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Zinc finger protein 417 (ZNF417) Krueppel C2H2-type zinc-finger protein family Q8TAU3
Zinc finger protein 587 (ZNF587) Krueppel C2H2-type zinc-finger protein family Q96SQ5
Metastasis-associated protein MTA1 (MTA1) . Q13330
Zinc finger protein 580 (ZNF580) . Q9UK33
Zinc finger protein 581 (ZNF581) . Q9P0T4
Other
Click To Hide/Show 43 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Atos homolog protein B (ATOSB) ATOS family Q7L5A3
Bystin (BYSL) Bystin family Q13895
Nucleolar complex protein 4 homolog (NOC4L) CBF/MAK21 family Q9BVI4
Cyclin-dependent kinases regulatory subunit 1 (CKS1B) CKS family P61024
CWF19-like protein 2 (CWF19L2) CWF19 family Q2TBE0
Protein FAM161A (FAM161A) FAM161 family Q3B820
Protein FAM50B (FAM50B) FAM50 family Q9Y247
Protein FAM74A4/A6 (FAM74A4; FAM74A6) FAM74 family Q5TZK3
Pre-mRNA-splicing regulator WTAP (WTAP) Fl(2)d family Q15007
Fibroblast growth factor 12 (FGF12) Heparin-binding growth factors family P61328
Protein mago nashi homolog 2 (MAGOHB) Mago nashi family Q96A72
Microtubule-associated protein RP/EB family member 3 (MAPRE3) MAPRE family Q9UPY8
Iron-sulfur cluster assembly enzyme ISCU (ISCU) NifU family Q9H1K1
Periplakin (PPL) Plakin or cytolinker family O60437
Pre-mRNA-splicing factor 18 (PRPF18) PRP18 family Q99633
DNA repair protein RAD51 homolog 4 (RAD51D) RecA family O75771
Shiftless antiviral inhibitor of ribosomal frameshifting protein (SHFL) SHFL family Q9NUL5
U6 snRNA-associated Sm-like protein LSm4 (LSM4) SnRNP Sm proteins family Q9Y4Z0
Small nuclear ribonucleoprotein F (SNRPF) SnRNP Sm proteins family P62306
SNW domain-containing protein 1 (SNW1) SNW family Q13573
Speriolin-like protein (SPATC1L) Speriolin family Q9H0A9
Synaptotagmin-17 (SYT17) Synaptotagmin family Q9BSW7
Transcription elongation factor A protein 2 (TCEA2) TFS-II family Q15560
U2 small nuclear ribonucleoprotein A' (SNRPA1) U2 small nuclear ribonucleoprotein A family P09661
UPF0488 protein C8orf33 (C8orf33) UPF0488 family Q9H7E9
UPF0688 protein C1orf174 (C1orf174) UPF0688 family Q8IYL3
AFG2-interacting ribosome maturation factor (AIRIM) . Q9NX04
Armadillo repeat-containing protein 7 (ARMC7) . Q9H6L4
Chromobox protein homolog 8 (CBX8) . Q9HC52
Coiled-coil domain-containing protein 185 (CCDC185) . Q8N715
FERM domain-containing protein 6 (FRMD6) . Q96NE9
Four and a half LIM domains protein 2 (FHL2) . Q14192
LIM domain only protein 3 (LMO3) . Q8TAP4
LIM domain transcription factor LMO4 (LMO4) . P61968
Microspherule protein 1 (MCRS1) . Q96EZ8
Mitotic spindle assembly checkpoint protein MAD2B (MAD2L2) . Q9UI95
Mortality factor 4-like protein 1 (MORF4L1) . Q9UBU8
Mortality factor 4-like protein 2 (MORF4L2) . Q15014
Neuronal migration protein doublecortin (DCX) . O43602
Rhombotin-1 (LMO1) . P25800
RNA-binding protein 43 (RBM43) . Q6ZSC3
SH2 domain-containing protein 4A (SH2D4A) . Q9H788
Zinc finger matrin-type protein 2 (ZMAT2) . Q96NC0

References

1 Covalent Inhibition by a Natural Product-Inspired Latent Electrophile. J Am Chem Soc. 2023 May 24;145(20):11097-11109. doi: 10.1021/jacs.3c00598. Epub 2023 May 15.
2 Enhancing Cysteine Chemoproteomic Coverage through Systematic Assessment of Click Chemistry Product Fragmentation. Anal Chem. 2022 Mar 8;94(9):3800-3810. doi: 10.1021/acs.analchem.1c04402. Epub 2022 Feb 23.
Mass spectrometry data entry: PXD028853
3 Development of Photolenalidomide for Cellular Target Identification. J Am Chem Soc. 2022 Jan 12;144(1):606-614. doi: 10.1021/jacs.1c11920. Epub 2022 Jan 3.
4 Site-specific quantitative cysteine profiling with data-independent acquisition-based mass spectrometry. Methods Enzymol. 2023;679:295-322. doi: 10.1016/bs.mie.2022.07.037. Epub 2022 Sep 7.
Mass spectrometry data entry: PXD027578
5 DrugMap: A quantitative pan-cancer analysis of cysteine ligandability. Cell. 2024 May 9;187(10):2536-2556.e30. doi: 10.1016/j.cell.2024.03.027. Epub 2024 Apr 22.
Mass spectrometry data entry: PXD047840
6 2-Sulfonylpyridines as Tunable, Cysteine-Reactive Electrophiles. J Am Chem Soc. 2020 May 13;142(19):8972-8979. doi: 10.1021/jacs.0c02721. Epub 2020 Apr 29.