General Information of Target

Target ID LDTP05786
Target Name T-box transcription factor TBX2 (TBX2)
Gene Name TBX2
Gene ID 6909
Synonyms
T-box transcription factor TBX2; T-box protein 2
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MREPALAASAMAYHPFHAPRPADFPMSAFLAAAQPSFFPALALPPGALAKPLPDPGLAGA
AAAAAAAAAAAEAGLHVSALGPHPPAAHLRSLKSLEPEDEVEDDPKVTLEAKELWDQFHK
LGTEMVITKSGRRMFPPFKVRVSGLDKKAKYILLMDIVAADDCRYKFHNSRWMVAGKADP
EMPKRMYIHPDSPATGEQWMAKPVAFHKLKLTNNISDKHGFTILNSMHKYQPRFHIVRAN
DILKLPYSTFRTYVFPETDFIAVTAYQNDKITQLKIDNNPFAKGFRDTGNGRREKRKQLT
LPSLRLYEEHCKPERDGAESDASSCDPPPAREPPTSPGAAPSPLRLHRARAEEKSCAADS
DPEPERLSEERAGAPLGRSPAPDSASPTRLTEPERARERRSPERGKEPAESGGDGPFGLR
SLEKERAEARRKDEGRKEAAEGKEQGLAPLVVQTDSASPLGAGHLPGLAFSSHLHGQQFF
GPLGAGQPLFLHPGQFTMGPGAFSAMGMGHLLASVAGGGNGGGGGPGTAAGLDAGGLGPA
ASAASTAAPFPFHLSQHMLASQGIPMPTFGGLFPYPYTYMAAAAAAASALPATSAAAAAA
AAAGSLSRSPFLGSARPRLRFSPYQIPVTIPPSTSLLTTGLASEGSKAAGGNSREPSPLP
ELALRKVGAPSRGALSPSGSAKEAANELQSIQRLVSGLESQRALSPGRESPK
Target Bioclass
Transcription factor
Subcellular location
Nucleus
Function
Transcription factor which acts as a transcriptional repressor. May also function as a transcriptional activator. Binds to the palindromic T site 5'-TTCACACCTAGGTGTGAA-3' DNA sequence, or a half-site, which are present in the regulatory region of several genes. Required for cardiac atrioventricular canal formation. May cooperate with NKX2.5 to negatively modulate expression of NPPA/ANF in the atrioventricular canal. May play a role as a positive regulator of TGFB2 expression, perhaps acting in concert with GATA4 in the developing outflow tract myocardium. Plays a role in limb pattern formation. Acts as a transcriptional repressor of ADAM10 gene expression, perhaps in concert with histone deacetylase HDAC1 as cofactor. Involved in branching morphogenesis in both developing lungs and adult mammary glands, via negative modulation of target genes; acting redundantly with TBX3. Required, together with TBX3, to maintain cell proliferation in the embryonic lung mesenchyme; perhaps acting downstream of SHH, BMP and TGFbeta signaling. Involved in modulating early inner ear development, acting independently of, and also redundantly with TBX3, in different subregions of the developing ear. Acts as a negative regulator of PML function in cellular senescence. Acts as a negative regulator of expression of CDKN1A/p21, IL33 and CCN4; repression of CDKN1A is enhanced in response to UV-induced stress, perhaps as a result of phosphorylation by p38 MAPK. Negatively modulates expression of CDKN2A/p14ARF and CDH1/E-cadherin. Plays a role in induction of the epithelial-mesenchymal transition (EMT). Plays a role in melanocyte proliferation, perhaps via regulation of cyclin CCND1. Involved in melanogenesis, acting via negative modulation of expression of DHICA oxidase/TYRP1 and P protein/OCA2. Involved in regulating retinal pigment epithelium (RPE) cell proliferation, perhaps via negatively modulating transcription of the transcription factor CEBPD.
Uniprot ID
Q13207
Ensemble ID
ENST00000240328.4
HGNC ID
HGNC:11597

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 3 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
DBIA
 Probe Info 
C311(1.14)  LDD3380  [1]
AHL-Pu-1
 Probe Info 
C311(2.03)  LDD0171  [2]
NAIA_5
 Probe Info 
N.A.  LDD2223  [3]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0026  4SU-RNA+native RNA DM93 C311(2.03)  LDD0171  [2]
 LDCM0259  AC14 HEK-293T C311(1.02)  LDD1512  [4]
 LDCM0282  AC22 HEK-293T C311(0.96)  LDD1521  [4]
 LDCM0291  AC30 HEK-293T C311(0.93)  LDD1530  [4]
 LDCM0299  AC38 HEK-293T C311(1.00)  LDD1538  [4]
 LDCM0308  AC46 HEK-293T C311(1.02)  LDD1547  [4]
 LDCM0317  AC54 HEK-293T C311(1.04)  LDD1556  [4]
 LDCM0323  AC6 HEK-293T C311(1.08)  LDD1562  [4]
 LDCM0326  AC62 HEK-293T C311(1.10)  LDD1565  [4]
 LDCM0632  CL-Sc Hep-G2 C311(0.82)  LDD2227  [3]
 LDCM0368  CL10 HEK-293T C311(1.00)  LDD1572  [4]
 LDCM0410  CL22 HEK-293T C311(1.05)  LDD1614  [4]
 LDCM0423  CL34 HEK-293T C311(0.92)  LDD1627  [4]
 LDCM0436  CL46 HEK-293T C311(0.93)  LDD1640  [4]
 LDCM0449  CL58 HEK-293T C311(1.09)  LDD1652  [4]
 LDCM0463  CL70 HEK-293T C311(1.03)  LDD1666  [4]
 LDCM0476  CL82 HEK-293T C311(0.94)  LDD1679  [4]
 LDCM0489  CL94 HEK-293T C311(1.02)  LDD1692  [4]
 LDCM0022  KB02 A2058 C311(1.29)  LDD2253  [1]
 LDCM0023  KB03 A2058 C311(1.27)  LDD2670  [1]
 LDCM0024  KB05 OV-90 C311(1.14)  LDD3380  [1]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Protein PML (PML) . P29590
Other
Click To Hide/Show 5 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Ataxin-1-like (ATXN1L) ATXN1 family P0C7T5
Lipid transferase CIDEB (CIDEB) CIDE family Q9UHD4
CCR4-NOT transcription complex subunit 2 (CNOT2) CNOT2/3/5 family Q9NZN8
Cysteine-rich tail protein 1 (CYSRT1) CYSRT1 family A8MQ03
Tetratricopeptide repeat protein 19, mitochondrial (TTC19) TTC19 family Q6DKK2

References

1 DrugMap: A quantitative pan-cancer analysis of cysteine ligandability. Cell. 2024 May 9;187(10):2536-2556.e30. doi: 10.1016/j.cell.2024.03.027. Epub 2024 Apr 22.
Mass spectrometry data entry: PXD047840
2 Chemoproteomic capture of RNA binding activity in living cells. Nat Commun. 2023 Oct 7;14(1):6282. doi: 10.1038/s41467-023-41844-z.
Mass spectrometry data entry: PXD044625
3 N-Acryloylindole-alkyne (NAIA) enables imaging and profiling new ligandable cysteines and oxidized thiols by chemoproteomics. Nat Commun. 2023 Jun 15;14(1):3564. doi: 10.1038/s41467-023-39268-w.
Mass spectrometry data entry: PXD041264
4 Accelerating multiplexed profiling of protein-ligand interactions: High-throughput plate-based reactive cysteine profiling with minimal input. Cell Chem Biol. 2024 Mar 21;31(3):565-576.e4. doi: 10.1016/j.chembiol.2023.11.015. Epub 2023 Dec 19.
Mass spectrometry data entry: PXD044402