Details of the Target

General Information of Target

Target ID LDTP05717
Target Name BCL2/adenovirus E1B 19 kDa protein-interacting protein 3 (BNIP3)
Gene Name BNIP3
Gene ID 664
Synonyms
NIP3; BCL2/adenovirus E1B 19 kDa protein-interacting protein 3
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MSQNGAPGMQEESLQGSWVELHFSNNGNGGSVPASVSIYNGDMEKILLDAQHESGRSSSK
SSHCDSPPRSQTPQDTNRASETDTHSIGEKNSSQSEEDDIERRKEVESILKKNSDWIWDW
SSRPENIPPKEFLFKHPKRTATLSMRNTSVMKKGGIFSAEFLKVFLPSLLLSHLLAIGLG
IYIGRRLTTSTSTF
Target Bioclass
Transporter and channel
Family
NIP3 family
Subcellular location
Mitochondrion
Function
Apoptosis-inducing protein that can overcome BCL2 suppression. May play a role in repartitioning calcium between the two major intracellular calcium stores in association with BCL2. Involved in mitochondrial quality control via its interaction with SPATA18/MIEAP: in response to mitochondrial damage, participates in mitochondrial protein catabolic process (also named MALM) leading to the degradation of damaged proteins inside mitochondria. The physical interaction of SPATA18/MIEAP, BNIP3 and BNIP3L/NIX at the mitochondrial outer membrane regulates the opening of a pore in the mitochondrial double membrane in order to mediate the translocation of lysosomal proteins from the cytoplasm to the mitochondrial matrix. Plays an important role in the calprotectin (S100A8/A9)-induced cell death pathway.
Uniprot ID
Q12983
Ensemble ID
ENST00000368636.9
HGNC ID
HGNC:1084

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 7 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
DBIA
 Probe Info  		C129(1.20)  LDD3427  [1]
BTD
 Probe Info  		C129(0.49)  LDD2089  [2]
Acrolein
 Probe Info  		N.A.  LDD0227  [3]
IPM
 Probe Info  		N.A.  LDD0147  [4]
Phosphinate-6
 Probe Info  		N.A.  LDD0018  [5]
Crotonaldehyde
 Probe Info  		N.A.  LDD0219  [3]
Methacrolein
 Probe Info  		N.A.  LDD0218  [3]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0226  AC11 HEK-293T C129(0.98)  LDD1509  [6]
 LDCM0270  AC15 HEK-293T C129(1.16)  LDD1513  [6]
 LDCM0278  AC19 HEK-293T C129(1.23)  LDD1517  [6]
 LDCM0283  AC23 HEK-293T C129(1.06)  LDD1522  [6]
 LDCM0287  AC27 HEK-293T C129(0.91)  LDD1526  [6]
 LDCM0290  AC3 HEK-293T C129(0.96)  LDD1529  [6]
 LDCM0292  AC31 HEK-293T C129(1.07)  LDD1531  [6]
 LDCM0296  AC35 HEK-293T C129(0.99)  LDD1535  [6]
 LDCM0300  AC39 HEK-293T C129(1.33)  LDD1539  [6]
 LDCM0305  AC43 HEK-293T C129(1.03)  LDD1544  [6]
 LDCM0309  AC47 HEK-293T C129(1.05)  LDD1548  [6]
 LDCM0314  AC51 HEK-293T C129(1.00)  LDD1553  [6]
 LDCM0318  AC55 HEK-293T C129(0.96)  LDD1557  [6]
 LDCM0322  AC59 HEK-293T C129(0.89)  LDD1561  [6]
 LDCM0327  AC63 HEK-293T C129(1.14)  LDD1566  [6]
 LDCM0334  AC7 HEK-293T C129(0.97)  LDD1568  [6]
 LDCM0369  CL100 HEK-293T C129(1.02)  LDD1573  [6]
 LDCM0372  CL103 HEK-293T C129(1.03)  LDD1576  [6]
 LDCM0373  CL104 HEK-293T C129(0.88)  LDD1577  [6]
 LDCM0376  CL107 HEK-293T C129(0.88)  LDD1580  [6]
 LDCM0377  CL108 HEK-293T C129(1.00)  LDD1581  [6]
 LDCM0379  CL11 HEK-293T C129(1.05)  LDD1583  [6]
 LDCM0381  CL111 HEK-293T C129(0.97)  LDD1585  [6]
 LDCM0382  CL112 HEK-293T C129(1.02)  LDD1586  [6]
 LDCM0385  CL115 HEK-293T C129(1.00)  LDD1589  [6]
 LDCM0386  CL116 HEK-293T C129(0.99)  LDD1590  [6]
 LDCM0389  CL119 HEK-293T C129(0.99)  LDD1593  [6]
 LDCM0391  CL120 HEK-293T C129(0.98)  LDD1595  [6]
 LDCM0394  CL123 HEK-293T C129(0.81)  LDD1598  [6]
 LDCM0395  CL124 HEK-293T C129(0.85)  LDD1599  [6]
 LDCM0398  CL127 HEK-293T C129(0.76)  LDD1602  [6]
 LDCM0399  CL128 HEK-293T C129(0.91)  LDD1603  [6]
 LDCM0402  CL15 HEK-293T C129(0.96)  LDD1606  [6]
 LDCM0403  CL16 HEK-293T C129(0.94)  LDD1607  [6]
 LDCM0406  CL19 HEK-293T C129(0.96)  LDD1610  [6]
 LDCM0411  CL23 HEK-293T C129(1.19)  LDD1615  [6]
 LDCM0415  CL27 HEK-293T C129(0.96)  LDD1619  [6]
 LDCM0416  CL28 HEK-293T C129(1.01)  LDD1620  [6]
 LDCM0418  CL3 HEK-293T C129(0.86)  LDD1622  [6]
 LDCM0420  CL31 HEK-293T C129(0.96)  LDD1624  [6]
 LDCM0424  CL35 HEK-293T C129(1.23)  LDD1628  [6]
 LDCM0428  CL39 HEK-293T C129(1.08)  LDD1632  [6]
 LDCM0429  CL4 HEK-293T C129(0.84)  LDD1633  [6]
 LDCM0430  CL40 HEK-293T C129(1.15)  LDD1634  [6]
 LDCM0433  CL43 HEK-293T C129(0.96)  LDD1637  [6]
 LDCM0437  CL47 HEK-293T C129(1.23)  LDD1641  [6]
 LDCM0443  CL52 HEK-293T C129(0.98)  LDD1646  [6]
 LDCM0446  CL55 HEK-293T C129(1.03)  LDD1649  [6]
 LDCM0450  CL59 HEK-293T C129(1.13)  LDD1653  [6]
 LDCM0455  CL63 HEK-293T C129(0.92)  LDD1658  [6]
 LDCM0456  CL64 HEK-293T C129(0.99)  LDD1659  [6]
 LDCM0459  CL67 HEK-293T C129(1.02)  LDD1662  [6]
 LDCM0462  CL7 HEK-293T C129(0.95)  LDD1665  [6]
 LDCM0464  CL71 HEK-293T C129(1.13)  LDD1667  [6]
 LDCM0469  CL76 HEK-293T C129(0.95)  LDD1672  [6]
 LDCM0472  CL79 HEK-293T C129(0.93)  LDD1675  [6]
 LDCM0477  CL83 HEK-293T C129(1.06)  LDD1680  [6]
 LDCM0481  CL87 HEK-293T C129(0.70)  LDD1684  [6]
 LDCM0482  CL88 HEK-293T C129(0.80)  LDD1685  [6]
 LDCM0486  CL91 HEK-293T C129(1.02)  LDD1689  [6]
 LDCM0490  CL95 HEK-293T C129(1.06)  LDD1693  [6]
 LDCM0494  CL99 HEK-293T C129(0.92)  LDD1697  [6]
 LDCM0495  E2913 HEK-293T C129(1.08)  LDD1698  [6]
 LDCM0213  Electrophilic fragment 2 MDA-MB-231 C129(1.70)  LDD1702  [2]
 LDCM0468  Fragment33 HEK-293T C129(0.89)  LDD1671  [6]
 LDCM0022  KB02 HEK-293T C129(0.99)  LDD1492  [6]
 LDCM0023  KB03 HEK-293T C129(0.88)  LDD1497  [6]
 LDCM0024  KB05 SK-MEL-28 C129(1.20)  LDD3427  [1]
 LDCM0109  NEM HeLa N.A.  LDD0227  [3]
 LDCM0496  Nucleophilic fragment 11a MDA-MB-231 C129(0.49)  LDD2089  [2]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 10 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Palmitoyltransferase ZDHHC15 (ZDHHC15) DHHC palmitoyltransferase family Q96MV8
3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase (EBP) EBP family Q15125
Very long chain fatty acid elongase 4 (ELOVL4) ELO family Q9GZR5
Serine protease hepsin (HPN) Peptidase S1 family P05981
Protein phosphatase PTC7 homolog (PPTC7) PP2C family Q8NI37
Ribonuclease kappa (RNASEK) RNase K family Q6P5S7
ADP-ribosylation factor-like protein 13B (ARL13B) Arf family Q3SXY8
TLC domain-containing protein 4 (TLCD4) TLCD4 family Q96MV1
Dynamin-like 120 kDa protein, mitochondrial (OPA1) Dynamin/Fzo/YdjA family O60313
BCL2/adenovirus E1B 19 kDa protein-interacting protein 2 (BNIP2) . Q12982
Transporter and channel
Click To Hide/Show 15 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Protein SLC31A2 (SLC31A2) Copper transporter (Ctr) (TC 1.A.56) family O15432
Transmembrane 4 L6 family member 18 (TM4SF18) L6 tetraspanin family Q96CE8
Hippocampus abundant transcript-like protein 1 (MFSD14B) Major facilitator superfamily Q5SR56
Membrane-spanning 4-domains subfamily A member 3 (MS4A3) MS4A family Q96HJ5
BCL2/adenovirus E1B 19 kDa protein-interacting protein 3 (BNIP3) NIP3 family Q12983
BCL2/adenovirus E1B 19 kDa protein-interacting protein 3-like (BNIP3L) NIP3 family O60238
Solute carrier family 35 member B1 (SLC35B1) Nucleotide-sugar transporter family P78383
Sodium channel regulatory subunit beta-3 (SCN3B) Sodium channel auxiliary subunit SCN3B family Q9NY72
Sodium-dependent neutral amino acid transporter SLC6A17 (SLC6A17) Sodium:neurotransmitter symporter (SNF) (TC 2.A.22) family Q9H1V8
Transmembrane protein 106C (TMEM106C) TMEM106 family Q9BVX2
Transmembrane protein 205 (TMEM205) TMEM205 family Q6UW68
Proteolipid protein 2 (PLP2) . Q04941
T-cell surface glycoprotein CD3 epsilon chain (CD3E) . P07766
Thioredoxin-related transmembrane protein 2 (TMX2) . Q9Y320
Transmembrane protein 101 (TMEM101) . Q96IK0
Transcription factor
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Cyclic AMP-responsive element-binding protein 3-like protein 1 (CREB3L1) BZIP family Q96BA8
GPCR
Click To Hide/Show 3 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Free fatty acid receptor 2 (FFAR2) G-protein coupled receptor 1 family O15552
G-protein coupled receptor 42 (GPR42) G-protein coupled receptor 1 family O15529
Probable G-protein coupled receptor 152 (GPR152) G-protein coupled receptor 1 family Q8TDT2
Immunoglobulin
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Amphoterin-induced protein 1 (AMIGO1) AMIGO family Q86WK6
Cytokine and receptor
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Interferon gamma receptor 2 (IFNGR2) Type II cytokine receptor family P38484
Other
Click To Hide/Show 19 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Claudin-9 (CLDN9) Claudin family O95484
Receptor expression-enhancing protein 2 (REEP2) DP1 family Q9BRK0
Endoplasmic reticulum-Golgi intermediate compartment protein 3 (ERGIC3) ERGIC family Q9Y282
Protein FAM209A (FAM209A) FAM209 family Q5JX71
Protein FAM3C (FAM3C) FAM3 family Q92520
Protein jagunal homolog 1 (JAGN1) Jagunal family Q8N5M9
Kinectin (KTN1) Kinectin family Q86UP2
Low-density lipoprotein receptor class A domain-containing protein 1 (LDLRAD1) LDLR family Q5T700
MAL-like protein (MALL) MAL family Q13021
Protein reprimo (RPRM) Reprimo family Q9NS64
Protein transport protein Sec23A (SEC23A) SEC23/SEC24 family Q15436
Vesicle-trafficking protein SEC22a (SEC22A) Synaptobrevin family Q96IW7
Transmembrane protein 11, mitochondrial (TMEM11) TMEM11 family P17152
Bcl-2-interacting killer (BIK) . Q13323
C-type lectin domain family 7 member A (CLEC7A) . Q9BXN2
Fetal and adult testis-expressed transcript protein (FATE1) . Q969F0
Receptor-binding cancer antigen expressed on SiSo cells (EBAG9) . O00559
Small integral membrane protein 3 (SMIM3) . Q9BZL3
Sperm acrosome membrane-associated protein 1 (SPACA1) . Q9HBV2

References

1 DrugMap: A quantitative pan-cancer analysis of cysteine ligandability. Cell. 2024 May 9;187(10):2536-2556.e30. doi: 10.1016/j.cell.2024.03.027. Epub 2024 Apr 22.
Mass spectrometry data entry: PXD047840
2 Nucleophilic covalent ligand discovery for the cysteine redoxome. Nat Chem Biol. 2023 Nov;19(11):1309-1319. doi: 10.1038/s41589-023-01330-5. Epub 2023 May 29.
Mass spectrometry data entry: PXD039908 , PXD029761
3 ACR-Based Probe for the Quantitative Profiling of Histidine Reactivity in the Human Proteome. J Am Chem Soc. 2023 Mar 8;145(9):5252-5260. doi: 10.1021/jacs.2c12653. Epub 2023 Feb 27.
4 Chemoproteomic Profiling by Cysteine Fluoroalkylation Reveals Myrocin G as an Inhibitor of the Nonhomologous End Joining DNA Repair Pathway. J Am Chem Soc. 2021 Dec 8;143(48):20332-20342. doi: 10.1021/jacs.1c09724. Epub 2021 Nov 24.
Mass spectrometry data entry: PXD029255
5 DFT-Guided Discovery of Ethynyl-Triazolyl-Phosphinates as Modular Electrophiles for Chemoselective Cysteine Bioconjugation and Profiling. Angew Chem Int Ed Engl. 2022 Oct 10;61(41):e202205348. doi: 10.1002/anie.202205348. Epub 2022 Aug 22.
Mass spectrometry data entry: PXD033004
6 Accelerating multiplexed profiling of protein-ligand interactions: High-throughput plate-based reactive cysteine profiling with minimal input. Cell Chem Biol. 2024 Mar 21;31(3):565-576.e4. doi: 10.1016/j.chembiol.2023.11.015. Epub 2023 Dec 19.
Mass spectrometry data entry: PXD044402