General Information of Target

Target ID LDTP05156
Target Name Neutrophil gelatinase-associated lipocalin (LCN2)
Gene Name LCN2
Gene ID 3934
Synonyms
HNL; NGAL; Neutrophil gelatinase-associated lipocalin; NGAL; 25 kDa alpha-2-microglobulin-related subunit of MMP-9; Lipocalin-2; Oncogene 24p3; Siderocalin; p25
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MPLGLLWLGLALLGALHAQAQDSTSDLIPAPPLSKVPLQQNFQDNQFQGKWYVVGLAGNA
ILREDKDPQKMYATIYELKEDKSYNVTSVLFRKKKCDYWIRTFVPGCQPGEFTLGNIKSY
PGLTSYLVRVVSTNYNQHAMVFFKKVSQNREYFKITLYGRTKELTSELKENFIRFSKSLG
LPENHIVFPVPIDQCIDG
Target Type
Literature-reported
Target Bioclass
Other
Family
Calycin superfamily, Lipocalin family
Subcellular location
Secreted
Function
Iron-trafficking protein involved in multiple processes such as apoptosis, innate immunity and renal development. Binds iron through association with 2,3-dihydroxybenzoic acid (2,3-DHBA), a siderophore that shares structural similarities with bacterial enterobactin, and delivers or removes iron from the cell, depending on the context. Iron-bound form (holo-24p3) is internalized following binding to the SLC22A17 (24p3R) receptor, leading to release of iron and subsequent increase of intracellular iron concentration. In contrast, association of the iron-free form (apo-24p3) with the SLC22A17 (24p3R) receptor is followed by association with an intracellular siderophore, iron chelation and iron transfer to the extracellular medium, thereby reducing intracellular iron concentration. Involved in apoptosis due to interleukin-3 (IL3) deprivation: iron-loaded form increases intracellular iron concentration without promoting apoptosis, while iron-free form decreases intracellular iron levels, inducing expression of the proapoptotic protein BCL2L11/BIM, resulting in apoptosis. Involved in innate immunity; limits bacterial proliferation by sequestering iron bound to microbial siderophores, such as enterobactin. Can also bind siderophores from M.tuberculosis.
TTD ID
T72010
Uniprot ID
P80188
DrugMap ID
TTKTLAI
Ensemble ID
ENST00000277480.7
HGNC ID
HGNC:6526

Target Site Mutations in Different Cell Lines

Cell line Mutation details Probe for labeling this protein in this cell
PANC1 SNV: p.M140T .

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 2 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
DBIA
 Probe Info 
C195(1.24)  LDD3312  [1]
JZ128-DTB
 Probe Info 
N.A.  LDD0462  [2]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0179  JZ128 PC-3 N.A.  LDD0462  [2]
 LDCM0022  KB02 786-O C107(1.65)  LDD2247  [1]
 LDCM0023  KB03 786-O C107(1.86)  LDD2664  [1]
 LDCM0024  KB05 HMCB C195(1.24)  LDD3312  [1]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 17 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
5'-3' exoribonuclease 2 (XRN2) 5'-3' exonuclease family Q9H0D6
Alpha-ketoglutarate-dependent dioxygenase alkB homolog 4 (ALKBH4) AlkB family Q9NXW9
Peroxisomal bifunctional enzyme (EHHADH) Enoyl-CoA hydratase/isomerase family; 3-hydroxyacyl-CoA dehydrogenase family Q08426
Endonuclease 8-like 2 (NEIL2) FPG family Q969S2
5'-deoxynucleotidase HDDC2 (HDDC2) HDDC2 family Q7Z4H3
E3 ubiquitin-protein ligase pellino homolog 1 (PELI1) Pellino family Q96FA3
Protein disulfide-isomerase (P4HB) Protein disulfide isomerase family P07237
Protein disulfide-isomerase A4 (PDIA4) Protein disulfide isomerase family P13667
5'-AMP-activated protein kinase catalytic subunit alpha-2 (PRKAA2) CAMK Ser/Thr protein kinase family P54646
Peptidyl-tRNA hydrolase (PTRH1) PTH family Q86Y79
Thioredoxin, mitochondrial (TXN2) Thioredoxin family Q99757
E3 ubiquitin-protein ligase TRIM32 (TRIM32) TRIM/RBCC family Q13049
NEDD8-conjugating enzyme UBE2F (UBE2F) Ubiquitin-conjugating enzyme family Q969M7
Tumor susceptibility gene 101 protein (TSG101) Ubiquitin-conjugating enzyme family Q99816
Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 2 (CTDSP2) . O14595
E3 SUMO-protein ligase ZBED1 (ZBED1) . O96006
Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 (PIN1) . Q13526
Transporter and channel
Click To Hide/Show 5 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Receptor activity-modifying protein 2 (RAMP2) RAMP family O60895
Protein transport protein Sec61 subunit gamma (SEC61G) SecE/SEC61-gamma family P60059
TP53-regulated inhibitor of apoptosis 1 (TRIAP1) TRIAP1/MDM35 family O43715
Guided entry of tail-anchored proteins factor CAMLG (CAMLG) . P49069
Sodium channel modifier 1 (SCNM1) . Q9BWG6
Transcription factor
Click To Hide/Show 2 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Vascular endothelial zinc finger 1 (VEZF1) Krueppel C2H2-type zinc-finger protein family Q14119
POU domain, class 4, transcription factor 2 (POU4F2) POU transcription factor family Q12837
Immunoglobulin
Click To Hide/Show 2 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
CXADR-like membrane protein (CLMP) . Q9H6B4
Leukocyte-associated immunoglobulin-like receptor 2 (LAIR2) . Q6ISS4
Other
Click To Hide/Show 20 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Ankyrin repeat and SOCS box protein 10 (ASB10) Ankyrin SOCS box (ASB) family Q8WXI3
Bcl-2-modifying factor (BMF) Bcl-2 family Q96LC9
Protein BEX2 (BEX2) BEX family Q9BXY8
Neutrophil gelatinase-associated lipocalin (LCN2) Lipocalin family P80188
Cysteine-rich hydrophobic domain-containing protein 2 (CHIC2) CHIC family Q9UKJ5
Cyclin-C (CCNC) Cyclin family P24863
Protein FAM25C (FAM25C) FAM25 family B3EWG5
Late cornified envelope protein 3A (LCE3A) LCE family Q5TA76
Myeloid-derived growth factor (MYDGF) MYDGF family Q969H8
Small glutamine-rich tetratricopeptide repeat-containing protein alpha (SGTA) SGT family O43765
Small glutamine-rich tetratricopeptide repeat-containing protein beta (SGTB) SGT family Q96EQ0
Pro-thyrotropin-releasing hormone (TRH) TRH family P20396
Ciliary microtubule inner protein 1 (CIMIP1) . Q9H1P6
Lymphocyte antigen 96 (LY96) . Q9Y6Y9
Melanoma-associated antigen D4 (MAGED4; MAGED4B) . Q96JG8
Odontogenesis associated phosphoprotein (ODAPH) . Q17RF5
PRKCA-binding protein (PICK1) . Q9NRD5
TBC1 domain family member 21 (TBC1D21) . Q8IYX1
Ubiquilin-1 (UBQLN1) . Q9UMX0
Ubiquilin-2 (UBQLN2) . Q9UHD9

The Drug(s) Related To This Target

Investigative
Click To Hide/Show 6 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
23-dihydroxy-benzoic Acid . DB01672
23-dihydroxybenzoylserine . DB02710
Carboxymycobactin S . DB01926
Carboxymycobactin T . DB04043
Methyl Nonanoate . DB01631
Trencam-32-hopo . DB04476

References

1 DrugMap: A quantitative pan-cancer analysis of cysteine ligandability. Cell. 2024 May 9;187(10):2536-2556.e30. doi: 10.1016/j.cell.2024.03.027. Epub 2024 Apr 22.
Mass spectrometry data entry: PXD047840
2 A Chemoproteomic Strategy for Direct and Proteome-Wide Covalent Inhibitor Target-Site Identification. J Am Chem Soc. 2019 Jan 9;141(1):191-203. doi: 10.1021/jacs.8b07911. Epub 2018 Dec 20.