Details of the Target

General Information of Target

Target ID LDTP05106
Target Name Cancer/testis antigen 1 (CTAG1A; CTAG1B)
Gene Name CTAG1A; CTAG1B
Gene ID 1485
Synonyms
CTAG; CTAG1; ESO1; LAGE2; LAGE2A; LAGE2B; Cancer/testis antigen 1; Autoimmunogenic cancer/testis antigen NY-ESO-1; Cancer/testis antigen 6.1; CT6.1; L antigen family member 2; LAGE-2
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MQAEGRGTGGSTGDADGPGGPGIPDGPGGNAGGPGEAGATGGRGPRGAGAARASGPGGGA
PRGPHGGAASGLNGCCRCGARGPESRLLEFYLAMPFATPMEAELARRSLAQDAPPLPVPG
VLLKEFTVSGNILTIRLTAADHRQLQLSISSCLQQLSLLMWITQCFLPVFLAQPPSGQRR
Target Type
Clinical trial
Target Bioclass
Other
Family
CTAG/PCC1 family
Subcellular location
Cytoplasm
TTD ID
T82277
Uniprot ID
P78358
DrugMap ID
TTE5ITK
Ensemble ID
ENST00000328435.3
HGNC ID
HGNC:24198
ChEMBL ID
CHEMBL4804257

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 2 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
m-APA
 Probe Info  		15.00  LDD0402  [1]
EA-probe
 Probe Info  		N.A.  LDD0440  [2]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0156  Aniline NCI-H1299 12.67  LDD0403  [1]
 LDCM0175  Ethacrynic acid HeLa N.A.  LDD0440  [2]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 14 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Desumoylating isopeptidase 1 (DESI1) DeSI family Q6ICB0
Glutamyl-tRNA(Gln) amidotransferase subunit C, mitochondrial (GATC) GatC family O43716
Polyunsaturated fatty acid lipoxygenase ALOX15B (ALOX15B) Lipoxygenase family O15296
Protein N-terminal glutamine amidohydrolase (NTAQ1) NTAQ1 family Q96HA8
Prolyl 4-hydroxylase subunit alpha-3 (P4HA3) P4HA family Q7Z4N8
Proteasome subunit beta type-1 (PSMB1) Peptidase T1B family P20618
Tribbles homolog 3 (TRIB3) CAMK Ser/Thr protein kinase family Q96RU7
MTRF1L release factor glutamine methyltransferase (HEMK1) Protein N5-glutamine methyltransferase family Q9Y5R4
Kinesin-like protein KIF26A (KIF26A) Kinesin family Q9ULI4
Ubiquitin-conjugating enzyme E2 variant 1 (UBE2V1) Ubiquitin-conjugating enzyme family Q13404
Reticulon-4-interacting protein 1, mitochondrial (RTN4IP1) Zinc-containing alcohol dehydrogenase family Q8WWV3
Fibronectin type III and SPRY domain-containing protein 2 (FSD2) . A1L4K1
LON peptidase N-terminal domain and RING finger protein 3 (LONRF3) . Q496Y0
Sulfite oxidase, mitochondrial (SUOX) . P51687
Transporter and channel
Click To Hide/Show 4 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Hsp90 co-chaperone Cdc37 (CDC37) CDC37 family Q16543
AP-4 complex accessory subunit Tepsin (TEPSIN) . Q96N21
SEC14-like protein 4 (SEC14L4) . Q9UDX3
THO complex subunit 1 (THOC1) . Q96FV9
Transcription factor
Click To Hide/Show 4 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
High mobility group protein 20A (HMG20A) . Q9NP66
Homeobox protein VENTX (VENTX) . O95231
Mesogenin-1 (MSGN1) . A6NI15
Spermatogenesis- and oogenesis-specific basic helix-loop-helix-containing protein 1 (SOHLH1) . Q5JUK2
Other
Click To Hide/Show 36 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Alpha-actinin-3 (ACTN3) Alpha-actinin family Q08043
Bcl-2-modifying factor (BMF) Bcl-2 family Q96LC9
Protein BEX1 (BEX1) BEX family Q9HBH7
Protein BEX2 (BEX2) BEX family Q9BXY8
BLOC-1-related complex subunit 8 (BORCS8) BORCS8 family Q96FH0
CDKN2AIP N-terminal-like protein (CDKN2AIPNL) CARF family Q96HQ2
Cancer/testis antigen 1 (CTAG1A; CTAG1B) CTAG/PCC1 family P78358
DNA damage-inducible transcript 4-like protein (DDIT4L) DDIT4 family Q96D03
Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-13 (GNG13) G protein gamma family Q9P2W3
Ragulator complex protein LAMTOR1 (LAMTOR1) LAMTOR1 family Q6IAA8
NGFI-A-binding protein 2 (NAB2) NAB family Q15742
PIH1 domain-containing protein 2 (PIH1D2) PIH1 family Q8WWB5
Ran-binding protein 10 (RANBP10) RANBP9/10 family Q6VN20
Neuronal calcium sensor 1 (NCS1) Recoverin family P62166
Arginine/serine-rich coiled-coil protein 2 (RSRC2) RSRC2 family Q7L4I2
Small glutamine-rich tetratricopeptide repeat-containing protein alpha (SGTA) SGT family O43765
Small glutamine-rich tetratricopeptide repeat-containing protein beta (SGTB) SGT family Q96EQ0
Suppressor of IKBKE 1 (SIKE1) SIKE family Q9BRV8
Nonsense-mediated mRNA decay factor SMG9 (SMG9) SMG9 family Q9H0W8
AFG2-interacting ribosome maturation factor (AIRIM) . Q9NX04
AP-4 complex accessory subunit RUSC1 (RUSC1) . Q9BVN2
Cleavage stimulation factor subunit 2 tau variant (CSTF2T) . Q9H0L4
Coiled-coil domain-containing protein 116 (CCDC116) . Q8IYX3
Coiled-coil-helix-coiled-coil-helix domain-containing protein 2 (CHCHD2) . Q9Y6H1
Cytohesin-4 (CYTH4) . Q9UIA0
G-protein-signaling modulator 3 (GPSM3) . Q9Y4H4
Kelch-like protein 38 (KLHL38) . Q2WGJ6
Melanoma-associated antigen C1 (MAGEC1) . O60732
Peflin (PEF1) . Q9UBV8
Required for excision 1-B domain-containing protein (REX1BD) . Q96EN9
Stimulated by retinoic acid gene 8 protein homolog (STRA8) . Q7Z7C7
Testis-specific protein 10-interacting protein (TSGA10IP) . Q3SY00
Ubiquilin-1 (UBQLN1) . Q9UMX0
Ubiquilin-2 (UBQLN2) . Q9UHD9
Ubiquitin-like protein 5 (UBL5) . Q9BZL1
Uncharacterized protein C14orf119 (C14orf119) . Q9NWQ9

The Drug(s) Related To This Target

Phase 2
Click To Hide/Show 3 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Anti-ny-eso-1 Car-t Cells CAR T Cell Therapy D0LJ2S
Cv-9201 Vaccine D02DVK
Cdx-1401 . D09TCY
Phase 1
Click To Hide/Show 4 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Gsk3845097 TCR-T cell therapy DS39MT
Gsk3901961 TCR-T cell therapy DHS3X7
Gsk-2241658a Vaccine D0IA5O
Ny-eso-1 Vaccine Vaccine D09XOF
Discontinued
Click To Hide/Show 1 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Melanoma Vaccine (Alvac) Vaccine D0C1EO

References

1 Quantitative and Site-Specific Chemoproteomic Profiling of Targets of Acrolein. Chem Res Toxicol. 2019 Mar 18;32(3):467-473. doi: 10.1021/acs.chemrestox.8b00343. Epub 2019 Jan 15.
2 Chemoproteomic Profiling Reveals Ethacrynic Acid Targets Adenine Nucleotide Translocases to Impair Mitochondrial Function. Mol Pharm. 2018 Jun 4;15(6):2413-2422. doi: 10.1021/acs.molpharmaceut.8b00250. Epub 2018 May 15.