Details of the Target

General Information of Target

Target ID LDTP04871
Target Name Gamma-aminobutyric acid receptor-associated protein-like 2 (GABARAPL2)
Gene Name GABARAPL2
Gene ID 11345
Synonyms
FLC3A; GEF2; Gamma-aminobutyric acid receptor-associated protein-like 2; GABA(A) receptor-associated protein-like 2; Ganglioside expression factor 2; GEF-2; General protein transport factor p16; Golgi-associated ATPase enhancer of 16 kDa; GATE-16; MAP1 light chain 3-related protein
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MKWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYLVPSDITVAQF
MWIIRKRIQLPSEKAIFLFVDKTVPQSSLTMGQLYEKEKDEDGFLYVAYSGENTFGF
Target Bioclass
Other
Family
ATG8 family
Subcellular location
Cytoplasmic vesicle, autophagosome
Function
Ubiquitin-like modifier involved in intra-Golgi traffic. Modulates intra-Golgi transport through coupling between NSF activity and SNAREs activation. It first stimulates the ATPase activity of NSF which in turn stimulates the association with GOSR1. Involved in autophagy. Plays a role in mitophagy which contributes to regulate mitochondrial quantity and quality by eliminating the mitochondria to a basal level to fulfill cellular energy requirements and preventing excess ROS production. Whereas LC3s are involved in elongation of the phagophore membrane, the GABARAP/GATE-16 subfamily is essential for a later stage in autophagosome maturation.
Uniprot ID
P60520
Ensemble ID
ENST00000037243.7
HGNC ID
HGNC:13291
ChEMBL ID
CHEMBL4879445

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 11 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
TH211
 Probe Info  		Y25(15.77)  LDD0257  [1]
DBIA
 Probe Info  		C15(1.54)  LDD3311  [2]
HHS-475
 Probe Info  		Y25(0.98)  LDD0264  [3]
HHS-465
 Probe Info  		Y25(9.08)  LDD2237  [4]
Acrolein
 Probe Info  		N.A.  LDD0221  [5]
ATP probe
 Probe Info  		N.A.  LDD0199  [6]
IA-alkyne
 Probe Info  		N.A.  LDD0167  [7]
NHS
 Probe Info  		N.A.  LDD0010  [8]
SF
 Probe Info  		N.A.  LDD0028  [9]
STPyne
 Probe Info  		N.A.  LDD0009  [8]
1c-yne
 Probe Info  		N.A.  LDD0228  [10]
PAL-AfBPP Probe
Click To Hide/Show 1 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
C362
 Probe Info  		26.72  LDD2023  [11]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0116  HHS-0101 DM93 Y25(0.98)  LDD0264  [3]
 LDCM0117  HHS-0201 DM93 Y25(0.73)  LDD0265  [3]
 LDCM0118  HHS-0301 DM93 Y25(0.84)  LDD0266  [3]
 LDCM0119  HHS-0401 DM93 Y25(0.89)  LDD0267  [3]
 LDCM0120  HHS-0701 DM93 Y25(1.18)  LDD0268  [3]
 LDCM0107  IAA HeLa N.A.  LDD0221  [5]
 LDCM0022  KB02 A101D C15(1.74)  LDD2250  [2]
 LDCM0023  KB03 A101D C15(2.46)  LDD2667  [2]
 LDCM0024  KB05 G361 C15(1.54)  LDD3311  [2]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 11 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Ubiquitin-like-conjugating enzyme ATG3 (ATG3) ATG3 family Q9NT62
Trifunctional enzyme subunit alpha, mitochondrial (HADHA) Enoyl-CoA hydratase/isomerase family; 3-hydroxyacyl-CoA dehydrogenase family P40939
Nucleotide triphosphate diphosphatase NUDT15 (NUDT15) Nudix hydrolase family Q9NV35
Serine/threonine-protein kinase SIK2 (SIK2) CAMK Ser/Thr protein kinase family Q9H0K1
Serine/threonine-protein kinase Nek9 (NEK9) NEK Ser/Thr protein kinase family Q8TD19
Serine/threonine-protein kinase ULK1 (ULK1) Ser/Thr protein kinase family O75385
Serine/threonine-protein kinase 3 (STK3) STE Ser/Thr protein kinase family Q13188
Serine/threonine-protein kinase 4 (STK4) STE Ser/Thr protein kinase family Q13043
Epidermal growth factor receptor (EGFR) Tyr protein kinase family P00533
Ubiquitin-like modifier-activating enzyme 5 (UBA5) Ubiquitin-activating E1 family Q9GZZ9
E3 ubiquitin-protein ligase NEDD4 (NEDD4) . P46934
Transporter and channel
Click To Hide/Show 11 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Autophagy-related protein 13 (ATG13) ATG13 family O75143
Autophagy-related protein 2 homolog A (ATG2A) ATG2 family Q2TAZ0
Ubiquitin-like modifier-activating enzyme ATG7 (ATG7) ATG7 family O95352
Importin-5 (IPO5) Importin beta family O00410
BCL2/adenovirus E1B 19 kDa protein-interacting protein 3-like (BNIP3L) NIP3 family O60238
Pericentriolar material 1 protein (PCM1) PCM1 family Q15154
Cysteine protease ATG4B (ATG4B) Peptidase C54 family Q9Y4P1
Autophagy-related protein 16-1 (ATG16L1) WD repeat ATG16 family Q676U5
FYVE and coiled-coil domain-containing protein 1 (FYCO1) . Q9BQS8
Starch-binding domain-containing protein 1 (STBD1) . O95210
TBC1 domain family member 5 (TBC1D5) . Q92609
Transcription factor
Click To Hide/Show 4 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Zinc finger protein 774 (ZNF774) Krueppel C2H2-type zinc-finger protein family Q6NX45
Leucine-zipper-like transcriptional regulator 1 (LZTR1) LZTR1 family Q8N653
Max-like protein X (MLX) . Q9UH92
Zinc finger and BTB domain-containing protein 2 (ZBTB2) . Q8N680
Other
Click To Hide/Show 37 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Bcl-2-like protein 13 (BCL2L13) Bcl-2 family Q9BXK5
Calcium-binding and coiled-coil domain-containing protein 1 (CALCOCO1) CALCOCO family Q9P1Z2
Calcium-binding and coiled-coil domain-containing protein 2 (CALCOCO2) CALCOCO family Q13137
Reticulocalbin-2 (RCN2) CREC family Q14257
Dynein light chain 1, cytoplasmic (DYNLL1) Dynein light chain family P63167
Dynein light chain 2, cytoplasmic (DYNLL2) Dynein light chain family Q96FJ2
FUN14 domain-containing protein 1 (FUNDC1) FUN14 family Q8IVP5
Inhibitory synaptic factor 1 (INSYN1) INSYN1 family Q2T9L4
Keratin-associated protein 10-7 (KRTAP10-7) KRTAP type 10 family P60409
Keratin-associated protein 10-9 (KRTAP10-9) KRTAP type 10 family P60411
Protein NipSnap homolog 2 (NIPSNAP2) NipSnap family O75323
Oxysterol-binding protein-related protein 3 (OSBPL3) OSBP family Q9H4L5
Reticulophagy regulator 3 (RETREG3) RETREG family Q86VR2
Pre-rRNA-processing protein TSR2 homolog (TSR2) TSR2 family Q969E8
Tectonin beta-propeller repeat-containing protein 2 (TECPR2) WD repeat KIAA0329 family O15040
ADP-ribosylation factor GTPase-activating protein 1 (ARFGAP1) . Q8N6T3
BSD domain-containing protein 1 (BSDC1) . Q9NW68
Dynein axonemal assembly factor 4 (DNAAF4) . Q8WXU2
Huntingtin-associated protein 1 (HAP1) . P54257
Kelch repeat and BTB domain-containing protein 6 (KBTBD6) . Q86V97
Kelch repeat and BTB domain-containing protein 7 (KBTBD7) . Q8WVZ9
Next to BRCA1 gene 1 protein (NBR1) . Q14596
Protein KASH5 (KASH5) . Q8N6L0
Rabankyrin-5 (ANKFY1) . Q9P2R3
Ras association domain-containing protein 1 (RASSF1) . Q9NS23
Ras association domain-containing protein 5 (RASSF5) . Q8WWW0
Sequestosome-1 (SQSTM1) . Q13501
Tax1-binding protein 1 (TAX1BP1) . Q86VP1
TBC1 domain family member 15 (TBC1D15) . Q8TC07
TBC1 domain family member 25 (TBC1D25) . Q3MII6
TBC1 domain family member 2B (TBC1D2B) . Q9UPU7
Testis-expressed protein 264 (TEX264) . Q9Y6I9
TNFAIP3-interacting protein 1 (TNIP1) . Q15025
Tumor protein p53-inducible nuclear protein 1 (TP53INP1) . Q96A56
Type-1 angiotensin II receptor-associated protein (AGTRAP) . Q6RW13
Uncharacterized protein KIAA1958 (KIAA1958) . Q8N8K9
WD repeat and FYVE domain-containing protein 3 (WDFY3) . Q8IZQ1

References

1 Chemoproteomic profiling of kinases in live cells using electrophilic sulfonyl triazole probes. Chem Sci. 2021 Jan 21;12(9):3295-3307. doi: 10.1039/d0sc06623k.
2 DrugMap: A quantitative pan-cancer analysis of cysteine ligandability. Cell. 2024 May 9;187(10):2536-2556.e30. doi: 10.1016/j.cell.2024.03.027. Epub 2024 Apr 22.
Mass spectrometry data entry: PXD047840
3 Discovery of a Cell-Active SuTEx Ligand of Prostaglandin Reductase 2. Chembiochem. 2021 Jun 15;22(12):2134-2139. doi: 10.1002/cbic.202000879. Epub 2021 Apr 29.
4 Global targeting of functional tyrosines using sulfur-triazole exchange chemistry. Nat Chem Biol. 2020 Feb;16(2):150-159. doi: 10.1038/s41589-019-0404-5. Epub 2019 Nov 25.
5 ACR-Based Probe for the Quantitative Profiling of Histidine Reactivity in the Human Proteome. J Am Chem Soc. 2023 Mar 8;145(9):5252-5260. doi: 10.1021/jacs.2c12653. Epub 2023 Feb 27.
6 Targeted Proteomic Approaches for Proteome-Wide Characterizations of the AMP-Binding Capacities of Kinases. J Proteome Res. 2022 Aug 5;21(8):2063-2070. doi: 10.1021/acs.jproteome.2c00225. Epub 2022 Jul 12.
7 SP3-FAIMS Chemoproteomics for High-Coverage Profiling of the Human Cysteinome*. Chembiochem. 2021 May 14;22(10):1841-1851. doi: 10.1002/cbic.202000870. Epub 2021 Feb 18.
Mass spectrometry data entry: PXD023056 , PXD023059 , PXD023058 , PXD023057 , PXD023060
8 A modification-centric assessment tool for the performance of chemoproteomic probes. Nat Chem Biol. 2022 Aug;18(8):904-912. doi: 10.1038/s41589-022-01074-8. Epub 2022 Jul 21.
Mass spectrometry data entry: PXD027758 , PXD027755 , PXD027760 , PXD027762 , PXD027756 , PXD027591 , PXD007149 , PXD030064 , PXD032392 , PXD027789 , PXD027767 , PXD027764
9 Solid Phase Synthesis of Fluorosulfate Containing Macrocycles for Chemoproteomic Workflows. bioRxiv [Preprint]. 2023 Feb 18:2023.02.17.529022. doi: 10.1101/2023.02.17.529022.
Mass spectrometry data entry: PXD039931
10 Tunable Amine-Reactive Electrophiles for Selective Profiling of Lysine. Angew Chem Int Ed Engl. 2022 Jan 26;61(5):e202112107. doi: 10.1002/anie.202112107. Epub 2021 Dec 16.
11 Large-scale chemoproteomics expedites ligand discovery and predicts ligand behavior in cells. Science. 2024 Apr 26;384(6694):eadk5864. doi: 10.1126/science.adk5864. Epub 2024 Apr 26.
Mass spectrometry data entry: PXD041587