Details of the Target

General Information of Target

Target ID LDTP04780
Target Name Ubiquitin-associated and SH3 domain-containing protein A (UBASH3A)
Gene Name UBASH3A
Gene ID 53347
Synonyms
STS2; Ubiquitin-associated and SH3 domain-containing protein A; Cbl-interacting protein 4; CLIP4; Suppressor of T-cell receptor signaling 2; STS-2; T-cell ubiquitin ligand 1; TULA-1
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MAAGETQLYAKVSNKLKSRSSPSLLEPLLAMGFPVHTALKALAATGRKTAEEALAWLHDH
CNDPSLDDPIPQEYALFLCPTGPLLEKLQEFWRESKRQCAKNRAHEVFPHVTLCDFFTCE
DQKVECLYEALKRAGDRLLGSFPTAVPLALHSSISYLGFFVSGSPADVIREFAMTFATEA
SLLAGTSVSRFWIFSQVPGHGPNLRLSNLTRASFVSHYILQKYCSVKPCTKQLHLTLAHK
FYPHHQRTLEQLARAIPLGHSCQWTAALYSRDMRFVHYQTLRALFQYKPQNVDELTLSPG
DYIFVDPTQQDEASEGWVIGISQRTGCRGFLPENYTDRASESDTWVKHRMYTFSLATDLN
SRKDGEASSRCSGEFLPQTARSLSSLQALQATVARKSVLVVRHGERVDQIFGKAWLQQCS
TPDGKYYRPDLNFPCSLPRRSRGIKDFENDPPLSSCGIFQSRIAGDALLDSGIRISSVFA
SPALRCVQTAKLILEELKLEKKIKIRVEPGIFEWTKWEAGKTTPTLMSLEELKEANFNID
TDYRPAFPLSALMPAESYQEYMDRCTASMVQIVNTCPQDTGVILIVSHGSTLDSCTRPLL
GLPPRECGDFAQLVRKIPSLGMCFCEENKEEGKWELVNPPVKTLTHGANAAFNWRNWISG
N
Target Bioclass
Other
Subcellular location
Cytoplasm
Function
Interferes with CBL-mediated down-regulation and degradation of receptor-type tyrosine kinases. Promotes accumulation of activated target receptors, such as T-cell receptors, EGFR and PDGFRB, on the cell surface. Exhibits negligible protein tyrosine phosphatase activity at neutral pH. May act as a dominant-negative regulator of UBASH3B-dependent dephosphorylation. May inhibit dynamin-dependent endocytic pathways by functionally sequestering dynamin via its SH3 domain.
Uniprot ID
P57075
Ensemble ID
ENST00000291535.11
HGNC ID
HGNC:12462

Target Site Mutations in Different Cell Lines

Cell line Mutation details Probe for labeling this protein in this cell
AN3CA SNV: p.T230S .
COLO792 SNV: p.E630K .
HCT116 SNV: p.E129V .
HT115 SNV: p.G510E; p.D540G .
LNCaP clone FGC SNV: p.T118A .
MELHO SNV: p.T591I .
P31FUJ SNV: p.R19S .
SAOS2 SNV: p.A149P .

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 5 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
IPM
 Probe Info  		C486(3.03)  LDD2229  [1]
DBIA
 Probe Info  		C262(23.88)  LDD0209  [2]
4-Iodoacetamidophenylacetylene
 Probe Info  		N.A.  LDD0038  [3]
IA-alkyne
 Probe Info  		C419(0.00); C435(0.00); C262(0.00)  LDD0036  [3]
Lodoacetamide azide
 Probe Info  		C419(0.00); C371(0.00); C435(0.00); C262(0.00)  LDD0037  [3]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0201  EV-3 T cell C435(7.97)  LDD0528  [4]
 LDCM0022  KB02 T cell C435(7.02)  LDD1703  [4]
 LDCM0023  KB03 Jurkat C262(23.88)  LDD0209  [2]
 LDCM0024  KB05 MOLM-16 C126(1.30)  LDD3334  [5]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 15 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Arrestin domain-containing protein 1 (ARRDC1) Arrestin family Q8N5I2
Putative histone-lysine N-methyltransferase PRDM6 (PRDM6) Class V-like SAM-binding methyltransferase superfamily Q9NQX0
Cystathionine beta-synthase (CBS) Cysteine synthase/cystathionine beta-synthase family P35520
Probable E3 ubiquitin-protein ligase DTX3 (DTX3) Deltex family Q8N9I9
Fatty acid desaturase 6 (FADS6) Fatty acid desaturase type 1 family Q8N9I5
Ubiquitin thioesterase ZRANB1 (ZRANB1) Peptidase C64 family Q9UGI0
Dynamin-2 (DNM2) Dynamin/Fzo/YdjA family P50570
E3 ubiquitin-protein ligase TRIM37 (TRIM37) TRIM/RBCC family O94972
E3 ubiquitin-protein ligase TRIM50 (TRIM50) TRIM/RBCC family Q86XT4
E3 ubiquitin-protein ligase TRIM8 (TRIM8) TRIM/RBCC family Q9BZR9
Zinc finger protein RFP (TRIM27) TRIM/RBCC family P14373
E3 ubiquitin-protein ligase CBL-B (CBLB) . Q13191
E3 ubiquitin-protein ligase LNX (LNX1) . Q8TBB1
E3 ubiquitin-protein ligase makorin-1 (MKRN1) . Q9UHC7
E3 ubiquitin-protein ligase RNF216 (RNF216) . Q9NWF9
Transporter and channel
Click To Hide/Show 4 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Arrestin domain-containing protein 3 (ARRDC3) Arrestin family Q96B67
Leucine zipper putative tumor suppressor 1 (LZTS1) LZTS family Q9Y250
Protein shisa-6 (SHISA6) Shisa family Q6ZSJ9
Mitochondrial import inner membrane translocase subunit TIM44 (TIMM44) Tim44 family O43615
Transcription factor
Click To Hide/Show 5 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Zinc finger protein 219 (ZNF219) Krueppel C2H2-type zinc-finger protein family Q9P2Y4
Zinc finger and BTB domain-containing protein 42 (ZBTB42) Krueppel C2H2-type zinc-finger protein family B2RXF5
Tumor protein 63 (TP63) P53 family Q9H3D4
Proto-oncogene c-Rel (REL) . Q04864
Zinc finger protein 474 (ZNF474) . Q6S9Z5
Other
Click To Hide/Show 37 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Neutrophil gelatinase-associated lipocalin (LCN2) Lipocalin family P80188
DNA damage-inducible transcript 4-like protein (DDIT4L) DDIT4 family Q96D03
Protein FAM83A (FAM83A) FAM83 family Q86UY5
Golgin subfamily A member 6-like protein 9 (GOLGA6L9) GOLGA6 family A6NEM1
Glial fibrillary acidic protein (GFAP) Intermediate filament family P14136
Keratin, type I cuticular Ha1 (KRT31) Intermediate filament family Q15323
Keratin, type I cuticular Ha2 (KRT32) Intermediate filament family Q14532
Keratin, type I cuticular Ha5 (KRT35) Intermediate filament family Q92764
Keratin, type I cytoskeletal 14 (KRT14) Intermediate filament family P02533
Keratin, type I cytoskeletal 39 (KRT39) Intermediate filament family Q6A163
Keratin, type I cytoskeletal 40 (KRT40) Intermediate filament family Q6A162
Leucine zipper putative tumor suppressor 2 (LZTS2) LZTS2 family Q9BRK4
NEDD4-binding protein 3 (N4BP3) N4BP3 family O15049
Paraneoplastic antigen-like protein 5 (PNMA5) PNMA family Q96PV4
Splicing factor 3B subunit 4 (SF3B4) SF3B4 family Q15427
Sperm microtubule inner protein 6 (SPMIP6) SMRP1 family Q8NCR6
Protein sprouty homolog 1 (SPRY1) Sprouty family O43609
Protein sprouty homolog 2 (SPRY2) Sprouty family O43597
Syntaxin-11 (STX11) Syntaxin family O75558
Tektin-1 (TEKT1) Tektin family Q969V4
Tektin-4 (TEKT4) Tektin family Q8WW24
Vacuolar protein sorting-associated protein 37B (VPS37B) VPS37 family Q9H9H4
Actin nucleation-promoting factor WAS (WAS) . P42768
Actin nucleation-promoting factor WASL (WASL) . O00401
Breast cancer anti-estrogen resistance protein 3 (BCAR3) . O75815
BTB/POZ domain-containing protein KCTD1 (KCTD1) . Q719H9
DAZ-associated protein 2 (DAZAP2) . Q15038
Keratinocyte proline-rich protein (KPRP) . Q5T749
Pleckstrin homology domain-containing family B member 2 (PLEKHB2) . Q96CS7
RING finger protein 11 (RNF11) . Q9Y3C5
Son of sevenless homolog 1 (SOS1) . Q07889
Src-like-adapter 2 (SLA2) . Q9H6Q3
Tax1-binding protein 1 (TAX1BP1) . Q86VP1
Transmembrane and coiled-coil domain-containing protein 2 (TMCO2) . Q7Z6W1
U11/U12 small nuclear ribonucleoprotein 48 kDa protein (SNRNP48) . Q6IEG0
Uncharacterized protein KIAA0408 (KIAA0408) . Q6ZU52
WW domain-binding protein 11 (WBP11) . Q9Y2W2

References

1 A quantitative thiol reactivity profiling platform to analyze redox and electrophile reactive cysteine proteomes. Nat Protoc. 2020 Sep;15(9):2891-2919. doi: 10.1038/s41596-020-0352-2. Epub 2020 Jul 20.
Mass spectrometry data entry: PXD016048
2 Covalent Inhibition by a Natural Product-Inspired Latent Electrophile. J Am Chem Soc. 2023 May 24;145(20):11097-11109. doi: 10.1021/jacs.3c00598. Epub 2023 May 15.
3 Enhancing Cysteine Chemoproteomic Coverage through Systematic Assessment of Click Chemistry Product Fragmentation. Anal Chem. 2022 Mar 8;94(9):3800-3810. doi: 10.1021/acs.analchem.1c04402. Epub 2022 Feb 23.
Mass spectrometry data entry: PXD028853
4 An Activity-Guided Map of Electrophile-Cysteine Interactions in Primary Human T Cells. Cell. 2020 Aug 20;182(4):1009-1026.e29. doi: 10.1016/j.cell.2020.07.001. Epub 2020 Jul 29.
5 DrugMap: A quantitative pan-cancer analysis of cysteine ligandability. Cell. 2024 May 9;187(10):2536-2556.e30. doi: 10.1016/j.cell.2024.03.027. Epub 2024 Apr 22.
Mass spectrometry data entry: PXD047840