Details of the Target
General Information of Target
| Target ID | LDTP04746 | |||||
|---|---|---|---|---|---|---|
| Target Name | NADH dehydrogenase 1 alpha subcomplex subunit 6 (NDUFA6) | |||||
| Gene Name | NDUFA6 | |||||
| Gene ID | 4700 | |||||
| Synonyms |
LYRM6; NADHB14; NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6; Complex I-B14; CI-B14; LYR motif-containing protein 6; NADH-ubiquinone oxidoreductase B14 subunit |
|||||
| 3D Structure | ||||||
| Sequence |
MAGSGVRQATSTASTFVKPIFSRDMNEAKRRVRELYRAWYREVPNTVHQFQLDITVKMGR
DKVREMFMKNAHVTDPRVVDLLVIKGKIELEETIKVWKQRTHVMRFFHETEAPRPKDFLS KFYVGHDP |
|||||
| Target Bioclass |
Enzyme
|
|||||
| Family |
Complex I LYR family
|
|||||
| Subcellular location |
Mitochondrion inner membrane
|
|||||
| Function |
Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed to be not involved in catalysis. Required for proper complex I assembly. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
| ChEMBL ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
STPyne Probe Info |
![]() |
K18(1.49); K85(8.12) | LDD0277 | [1] | |
|
5E-2FA Probe Info |
![]() |
N.A. | LDD2235 | [2] | |
|
ATP probe Probe Info |
![]() |
K85(0.00); K87(0.00) | LDD0199 | [3] | |
|
m-APA Probe Info |
![]() |
N.A. | LDD2231 | [2] | |
|
Acrolein Probe Info |
![]() |
N.A. | LDD0217 | [4] | |
|
Crotonaldehyde Probe Info |
![]() |
H108(0.00); H72(0.00) | LDD0219 | [4] | |
PAL-AfBPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
C158 Probe Info |
![]() |
8.88 | LDD1838 | [5] | |
|
C313 Probe Info |
![]() |
15.03 | LDD1980 | [5] | |
Competitor(s) Related to This Target
The Interaction Atlas With This Target
References








