Details of the Target
General Information of Target
| Target ID | LDTP04678 | |||||
|---|---|---|---|---|---|---|
| Target Name | Nck-associated protein 1-like (NCKAP1L) | |||||
| Gene Name | NCKAP1L | |||||
| Gene ID | 3071 | |||||
| Synonyms |
HEM1; Nck-associated protein 1-like; Hematopoietic protein 1; Membrane-associated protein HEM-1 |
|||||
| 3D Structure | ||||||
| Sequence |
MSLTSAYQHKLAEKLTILNDRGQGVLIRMYNIKKTCSDPKSKPPFLLEKSMEPSLKYINK
KFPNIDVRNSTQHLGPVHREKAEIIRFLTNYYQSFVDVMEFRDHVYELLNTIDACQCHFD INLNFDFTRSYLDLIVTYTSVILLLSRIEDRRILIGMYNCAHEMLHGHGDPSFARLGQMV LEYDHPLKKLTEEFGPHTKAVSGALLSLHFLFVRRNQGAEQWRSAQLLSLISNPPAMINP ANSDTMACEYLSVEVMERWIIIGFLLCHGCLNSNSQCQKLWKLCLQGSLYITLIREDVLQ VHKVTEDLFSSLKGYGKRVADIKESKEHVIANSGQFHCQRRQFLRMAVKELETVLADEPG LLGPKALFAFMALSFIRDEVTWLVRHTENVTKTKTPEDYADSSIAELLFLLEGIRSLVRR HIKVIQQYHLQYLARFDALVLSDIIQNLSVCPEEESIIMSSFVSILSSLNLKQVDNGEKF EFSGLRLDWFRLQAYTSVAKAPLHLHENPDLAKVMNLIVFHSRMLDSVEKLLVETSDLST FCFHLRIFEKMFAMTLEESAMLRYAIAFPLICAHFVHCTHEMCPEEYPHLKNHGLHHCNS FLEELAKQTSNCVLEICAEQRNLSEQLLPKHCATTISKAKNKKTRKQRQTPRKGEPERDK PGAESHRKNRSIVTNMDKLHLNLTELALTMNHVYSFSVFEHTIFPSEYLSSHLEARLNRA IVWLAGYNATTQEIVRPSELLAGVKAYIGFIQSLAQFLGADASRVIRNALLQQTQPLDSC GEQTITTLYTNWYLESLLRQASSGTIILSPAMQAFVSLPREGEQNFSAEEFSDISEMRAL AELLGPYGMKFLSENLMWHVTSQIVELKKLVVENMDILVQIRSNFSKPDLMASLLPQLTG AENVLKRMTIIGVILSFRAMAQEGLREVFSSHCPFLMGPIECLKEFVTPDTDIKVTLSIF ELASAAGVGCDIDPALVAAIANLKADTSSPEEEYKVACLLLIFLAVSLPLLATDPSSFYS IEKDGYNNNIHCLTKAIIQVSAALFTLYNKNIETHLKEFLVVASVSLLQLGQETDKLKTR NRESISLLMRLVVEESSFLTLDMLESCFPYVLLRNAYREVSRAFHLN |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
HEM-1/HEM-2 family
|
|||||
| Subcellular location |
Cell membrane
|
|||||
| Function |
Essential hematopoietic-specific regulator of the actin cytoskeleton (Probable). Controls lymphocyte development, activation, proliferation and homeostasis, erythrocyte membrane stability, as well as phagocytosis and migration by neutrophils and macrophages. Component of the WAVE2 complex which signals downstream of RAC to stimulate F-actin polymerization. Required for stabilization and/or translation of the WAVE2 complex proteins in hematopoietic cells. Within the WAVE2 complex, enables the cortical actin network to restrain excessive degranulation and granule release by T-cells. Required for efficient T-lymphocyte and neutrophil migration. Exhibits complex cycles of activation and inhibition to generate waves of propagating the assembly with actin. Also involved in mechanisms WAVE-independent to regulate myosin and actin polymerization during neutrophil chemotaxis. In T-cells, required for proper mechanistic target of rapamycin complex 2 (mTORC2)-dependent AKT phosphorylation, cell proliferation and cytokine secretion, including that of IL2 and TNF.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
| Cell line | Mutation details | Probe for labeling this protein in this cell | |||
|---|---|---|---|---|---|
| A549 | SNV: p.E961Ter | . | |||
| COLO792 | SNV: p.L1077F | . | |||
| CORL88 | SNV: p.F490I | . | |||
| HCC15 | SNV: p.V816L | . | |||
| HT115 | SNV: p.R907H; p.K1078T | . | |||
| MCC13 | SNV: p.S697F | . | |||
| MDAMB468 | SNV: p.R377H | . | |||
| MELJUSO | SNV: p.P63S | . | |||
| MEWO | Substitution: p.R28C | . | |||
| NCIH196 | SNV: p.H680Q | . | |||
| OCIAML2 | SNV: p.R214Q | DBIA Probe Info | |||
| RKO | SNV: p.R21H | . | |||
| SKMEL28 | SNV: p.R214Q; p.H337Y | . | |||
| WM793 | SNV: p.R621Q | . | |||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
![]() |
C982(6.43); C338(3.52) | LDD3333 | [1] | |
|
4-Iodoacetamidophenylacetylene Probe Info |
![]() |
C338(0.00); C632(0.00); C780(0.00); C160(0.00) | LDD0038 | [2] | |
|
IA-alkyne Probe Info |
![]() |
C338(0.00); C160(0.00); C542(0.00); C598(0.00) | LDD0036 | [2] | |
|
Lodoacetamide azide Probe Info |
![]() |
C1032(0.00); C780(0.00); C970(0.00); C338(0.00) | LDD0037 | [2] | |
|
Compound 10 Probe Info |
![]() |
N.A. | LDD2216 | [3] | |
|
Compound 11 Probe Info |
![]() |
N.A. | LDD2213 | [3] | |
PAL-AfBPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
VE-P Probe Info |
![]() |
N.A. | LDD0396 | [4] | |
Competitor(s) Related to This Target
| Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
|---|---|---|---|---|---|
| LDCM0625 | F8 | Ramos | C338(2.44) | LDD2187 | [5] |
| LDCM0572 | Fragment10 | Ramos | C338(1.22) | LDD2189 | [5] |
| LDCM0573 | Fragment11 | Ramos | C338(0.33) | LDD2190 | [5] |
| LDCM0574 | Fragment12 | Ramos | C338(0.74) | LDD2191 | [5] |
| LDCM0575 | Fragment13 | Ramos | C338(1.02) | LDD2192 | [5] |
| LDCM0576 | Fragment14 | Ramos | C338(0.89) | LDD2193 | [5] |
| LDCM0579 | Fragment20 | Ramos | C338(0.75) | LDD2194 | [5] |
| LDCM0580 | Fragment21 | Ramos | C338(0.73) | LDD2195 | [5] |
| LDCM0582 | Fragment23 | Ramos | C338(1.24) | LDD2196 | [5] |
| LDCM0578 | Fragment27 | Ramos | C338(1.94) | LDD2197 | [5] |
| LDCM0586 | Fragment28 | Ramos | C338(0.74) | LDD2198 | [5] |
| LDCM0588 | Fragment30 | Ramos | C338(1.21) | LDD2199 | [5] |
| LDCM0589 | Fragment31 | Ramos | C338(0.90) | LDD2200 | [5] |
| LDCM0590 | Fragment32 | Ramos | C338(1.25) | LDD2201 | [5] |
| LDCM0468 | Fragment33 | Ramos | C338(1.42) | LDD2202 | [5] |
| LDCM0596 | Fragment38 | Ramos | C338(2.17) | LDD2203 | [5] |
| LDCM0566 | Fragment4 | Ramos | C338(0.92) | LDD2184 | [5] |
| LDCM0610 | Fragment52 | Ramos | C338(1.43) | LDD2204 | [5] |
| LDCM0614 | Fragment56 | Ramos | C338(1.02) | LDD2205 | [5] |
| LDCM0569 | Fragment7 | Ramos | C338(5.42) | LDD2186 | [5] |
| LDCM0571 | Fragment9 | Ramos | C338(0.54) | LDD2188 | [5] |
| LDCM0022 | KB02 | Ramos | C338(3.83) | LDD2182 | [5] |
| LDCM0023 | KB03 | Ramos | C338(0.94) | LDD2183 | [5] |
| LDCM0024 | KB05 | MOLM-13 | C982(6.43); C338(3.52) | LDD3333 | [1] |
| LDCM0131 | RA190 | MM1.R | C942(1.09) | LDD0304 | [6] |
References







