General Information of Target

Target ID LDTP04419
Target Name RNA-binding protein Nova-1 (NOVA1)
Gene Name NOVA1
Gene ID 4857
Synonyms
RNA-binding protein Nova-1; Neuro-oncological ventral antigen 1; Onconeural ventral antigen 1; Paraneoplastic Ri antigen; Ventral neuron-specific protein 1
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MMAAAPIQQNGTHTGVPIDLDPPDSRKRPLEAPPEAGSTKRTNTGEDGQYFLKVLIPSYA
AGSIIGKGGQTIVQLQKETGATIKLSKSKDFYPGTTERVCLIQGTVEALNAVHGFIAEKI
REMPQNVAKTEPVSILQPQTTVNPDRIKQTLPSSPTTTKSSPSDPMTTSRANQVKIIVPN
STAGLIIGKGGATVKAVMEQSGAWVQLSQKPDGINLQERVVTVSGEPEQNRKAVELIIQK
IQEDPQSGSCLNISYANVTGPVANSNPTGSPYANTAEVLPTAAAAAGLLGHANLAGVAAF
PAVLSGFTGNDLVAITSALNTLASYGYNLNTLGLGLSQAAATGALAAAAASANPAAAAAN
LLATYASEASASGSTAGGTAGTFALGSLAAATAATNGYFGAASPLAASAILGTEKSTDGS
KDVVEIAVPENLVGAILGKGGKTLVEYQELTGARIQISKKGEFVPGTRNRKVTITGTPAA
TQAAQYLITQRITYEQGVRAANPQKVG
Target Bioclass
Other
Subcellular location
Nucleus
Function
Functions to regulate alternative splicing in neurons by binding pre-mRNA in a sequence-specific manner to activate exon inclusion or exclusion. It binds specifically to the sequences 5'-YCAY-3' and regulates splicing in only a subset of regulated exons. Binding to an exonic 5'-YCAY-3' cluster changes the protein complexes assembled on pre-mRNA, blocking U1 snRNP binding and exon inclusion, whereas binding to an intronic 5'-YCAY-3' cluster enhances spliceosome assembly and exon inclusion. Binding to 5'-YCAY-3' clusters results in a local and asymmetric action to regulate spliceosome assembly and alternative splicing in neurons. Binding to an exonic 5'-YCAY-3' cluster changed the protein complexes assembled on pre-mRNA, blocking U1 snRNP (small nuclear ribonucleoprotein) binding and exon inclusion, whereas binding to an intronic 5'-YCAY-3' cluster enhanced spliceosome assembly and exon inclusion. With NOVA1, they perform unique biological functions in different brain areas and cell types. Autoregulates its own expression by acting as a splicing repressor. Acts to activate the inclusion of exon E3A in the glycine receptor alpha-2 chain and of exon E9 in gamma-aminobutyric-acid receptor gamma-2 subunit via a distal downstream UCAU-rich intronic splicing enhancer. Acts to regulate a novel glycine receptor alpha-2 chain splice variant (alpha-2N) in developing spinal cord.
Uniprot ID
P51513
Ensemble ID
ENST00000344429.9
HGNC ID
HGNC:7886

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 2 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
DBIA
 Probe Info 
C100(0.96)  LDD1510  [1]
IA-alkyne
 Probe Info 
N.A.  LDD0165  [2]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0237  AC12 HEK-293T C100(0.96)  LDD1510  [1]
 LDCM0270  AC15 HEK-293T C100(0.90)  LDD1513  [1]
 LDCM0280  AC20 HEK-293T C100(1.04)  LDD1519  [1]
 LDCM0283  AC23 HEK-293T C100(0.76)  LDD1522  [1]
 LDCM0288  AC28 HEK-293T C100(1.27)  LDD1527  [1]
 LDCM0292  AC31 HEK-293T C100(1.15)  LDD1531  [1]
 LDCM0297  AC36 HEK-293T C100(1.10)  LDD1536  [1]
 LDCM0300  AC39 HEK-293T C100(1.07)  LDD1539  [1]
 LDCM0301  AC4 HEK-293T C100(1.20)  LDD1540  [1]
 LDCM0306  AC44 HEK-293T C100(1.12)  LDD1545  [1]
 LDCM0309  AC47 HEK-293T C100(1.26)  LDD1548  [1]
 LDCM0315  AC52 HEK-293T C100(1.18)  LDD1554  [1]
 LDCM0318  AC55 HEK-293T C100(0.96)  LDD1557  [1]
 LDCM0324  AC60 HEK-293T C100(1.01)  LDD1563  [1]
 LDCM0327  AC63 HEK-293T C100(1.07)  LDD1566  [1]
 LDCM0334  AC7 HEK-293T C100(1.46)  LDD1568  [1]
 LDCM0379  CL11 HEK-293T C100(0.74)  LDD1583  [1]
 LDCM0408  CL20 HEK-293T C100(1.22)  LDD1612  [1]
 LDCM0411  CL23 HEK-293T C100(0.96)  LDD1615  [1]
 LDCM0421  CL32 HEK-293T C100(0.88)  LDD1625  [1]
 LDCM0424  CL35 HEK-293T C100(1.19)  LDD1628  [1]
 LDCM0434  CL44 HEK-293T C100(1.13)  LDD1638  [1]
 LDCM0437  CL47 HEK-293T C100(0.85)  LDD1641  [1]
 LDCM0447  CL56 HEK-293T C100(1.07)  LDD1650  [1]
 LDCM0450  CL59 HEK-293T C100(0.90)  LDD1653  [1]
 LDCM0460  CL68 HEK-293T C100(1.16)  LDD1663  [1]
 LDCM0464  CL71 HEK-293T C100(1.21)  LDD1667  [1]
 LDCM0473  CL8 HEK-293T C100(0.95)  LDD1676  [1]
 LDCM0474  CL80 HEK-293T C100(1.34)  LDD1677  [1]
 LDCM0477  CL83 HEK-293T C100(1.01)  LDD1680  [1]
 LDCM0487  CL92 HEK-293T C100(0.78)  LDD1690  [1]
 LDCM0490  CL95 HEK-293T C100(1.11)  LDD1693  [1]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Transporter and channel
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Gamma-aminobutyric acid receptor subunit gamma-2 (GABRG2) Ligand-gated ion channel family P18507
GPCR
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
5-hydroxytryptamine receptor 6 (HTR6) G-protein coupled receptor 1 family P50406

References

1 Accelerating multiplexed profiling of protein-ligand interactions: High-throughput plate-based reactive cysteine profiling with minimal input. Cell Chem Biol. 2024 Mar 21;31(3):565-576.e4. doi: 10.1016/j.chembiol.2023.11.015. Epub 2023 Dec 19.
Mass spectrometry data entry: PXD044402
2 SP3-FAIMS Chemoproteomics for High-Coverage Profiling of the Human Cysteinome*. Chembiochem. 2021 May 14;22(10):1841-1851. doi: 10.1002/cbic.202000870. Epub 2021 Feb 18.
Mass spectrometry data entry: PXD023056 , PXD023059 , PXD023058 , PXD023057 , PXD023060