Details of the Target
General Information of Target
| Target ID | LDTP03804 | |||||
|---|---|---|---|---|---|---|
| Target Name | Transcription factor 7 (TCF7) | |||||
| Gene Name | TCF7 | |||||
| Gene ID | 6932 | |||||
| Synonyms |
TCF1; Transcription factor 7; TCF-7; T-cell-specific transcription factor 1; T-cell factor 1; TCF-1 |
|||||
| 3D Structure | ||||||
| Sequence |
MPQLDSGGGGAGGGDDLGAPDELLAFQDEGEEQDDKSRDSAAGPERDLAELKSSLVNESE
GAAGGAGIPGVPGAGAGARGEAEALGREHAAQRLFPDKLPEPLEDGLKAPECTSGMYKET VYSAFNLLMHYPPPSGAGQHPQPQPPLHKANQPPHGVPQLSLYEHFNSPHPTPAPADISQ KQVHRPLQTPDLSGFYSLTSGSMGQLPHTVSWFTHPSLMLGSGVPGHPAAIPHPAIVPPS GKQELQPFDRNLKTQAESKAEKEAKKPTIKKPLNAFMLYMKEMRAKVIAECTLKESAAIN QILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYGKKKRRSREKHQESTTET NWPRELKDGNGQESLSMSSSSSPA |
|||||
| Target Bioclass |
Transcription factor
|
|||||
| Family |
TCF/LEF family
|
|||||
| Subcellular location |
Nucleus
|
|||||
| Function |
Transcriptional activator involved in T-cell lymphocyte differentiation. Necessary for the survival of CD4(+) CD8(+) immature thymocytes. Isoforms lacking the N-terminal CTNNB1 binding domain cannot fulfill this role. Binds to the T-lymphocyte-specific enhancer element (5'-WWCAAAG-3') found in the promoter of the CD3E gene. Represses expression of the T-cell receptor gamma gene in alpha-beta T-cell lineages. Required for the development of natural killer receptor-positive lymphoid tissue inducer T-cells. TLE1, TLE2, TLE3 and TLE4 repress transactivation mediated by TCF7 and CTNNB1.May also act as feedback transcriptional repressor of CTNNB1 and TCF7L2 target genes.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
 |
C112(3.42) | LDD3331 | [1] | |
|
HPAP Probe Info |
 |
4.04 | LDD0064 | [2] | |
|
4-Iodoacetamidophenylacetylene Probe Info |
 |
N.A. | LDD0038 | [3] | |
|
IA-alkyne Probe Info |
 |
N.A. | LDD0036 | [3] | |
|
Lodoacetamide azide Probe Info |
 |
N.A. | LDD0037 | [3] | |
|
Compound 10 Probe Info |
 |
C112(0.00); C291(0.00) | LDD2216 | [4] | |
|
Compound 11 Probe Info |
 |
N.A. | LDD2213 | [4] | |
Competitor(s) Related to This Target
| Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
|---|---|---|---|---|---|
| LDCM0281 | AC21 | HEK-293T | C112(1.09) | LDD1520 | [5] |
| LDCM0289 | AC29 | HEK-293T | C112(1.05) | LDD1528 | [5] |
| LDCM0298 | AC37 | HEK-293T | C112(1.04) | LDD1537 | [5] |
| LDCM0307 | AC45 | HEK-293T | C112(0.97) | LDD1546 | [5] |
| LDCM0312 | AC5 | HEK-293T | C112(0.98) | LDD1551 | [5] |
| LDCM0316 | AC53 | HEK-293T | C112(0.86) | LDD1555 | [5] |
| LDCM0325 | AC61 | HEK-293T | C112(0.99) | LDD1564 | [5] |
| LDCM0248 | AKOS034007472 | HEK-293T | C112(0.97) | LDD1511 | [5] |
| LDCM0409 | CL21 | HEK-293T | C112(1.07) | LDD1613 | [5] |
| LDCM0422 | CL33 | HEK-293T | C112(1.04) | LDD1626 | [5] |
| LDCM0435 | CL45 | HEK-293T | C112(1.03) | LDD1639 | [5] |
| LDCM0448 | CL57 | HEK-293T | C112(1.02) | LDD1651 | [5] |
| LDCM0461 | CL69 | HEK-293T | C112(0.89) | LDD1664 | [5] |
| LDCM0475 | CL81 | HEK-293T | C112(0.99) | LDD1678 | [5] |
| LDCM0484 | CL9 | HEK-293T | C112(0.95) | LDD1687 | [5] |
| LDCM0488 | CL93 | HEK-293T | C112(1.05) | LDD1691 | [5] |
| LDCM0022 | KB02 | AGS | C112(2.93); C291(2.26) | LDD2263 | [1] |
| LDCM0023 | KB03 | AGS | C112(1.87) | LDD2680 | [1] |
| LDCM0024 | KB05 | MKN-1 | C112(3.42) | LDD3331 | [1] |
| LDCM0014 | Panhematin | hPBMC | 4.04 | LDD0064 | [2] |
The Interaction Atlas With This Target
References