Details of the Target
General Information of Target
| Target ID | LDTP03613 | |||||
|---|---|---|---|---|---|---|
| Target Name | DNA dC->dU-editing enzyme APOBEC-3A (APOBEC3A) | |||||
| Gene Name | APOBEC3A | |||||
| Gene ID | 100913187 | |||||
| Synonyms |
DNA dC->dU-editing enzyme APOBEC-3A; A3A; EC 3.5.4.38; Phorbolin-1 |
|||||
| 3D Structure | ||||||
| Sequence |
MEASPASGPRHLMDPHIFTSNFNNGIGRHKTYLCYEVERLDNGTSVKMDQHRGFLHNQAK
NLLCGFYGRHAELRFLDLVPSLQLDPAQIYRVTWFISWSPCFSWGCAGEVRAFLQENTHV RLRIFAARIYDYDPLYKEALQMLRDAGAQVSIMTYDEFKHCWDTFVDHQGCPFQPWDGLD EHSQALSGRLRAILQNQGN |
|||||
| Target Bioclass |
Enzyme
|
|||||
| Family |
Cytidine and deoxycytidylate deaminase family
|
|||||
| Subcellular location |
Nucleus
|
|||||
| Function |
DNA deaminase (cytidine deaminase) with restriction activity against viruses, foreign DNA and mobility of retrotransposons. Exhibits antiviral activity against adeno-associated virus (AAV) and human T-cell leukemia virus type 1 (HTLV-1) and may inhibit the mobility of LTR and non-LTR retrotransposons. Selectively targets single-stranded DNA and can deaminate both methylcytosine and cytosine in foreign DNA. Can induce somatic hypermutation in the nuclear and mitochondrial DNA. May also play a role in the epigenetic regulation of gene expression through the process of active DNA demethylation.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
| ChEMBL ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
IPM Probe Info |
 |
N.A. | LDD0241 | [1] | |
|
AHL-Pu-1 Probe Info |
 |
C64(2.90) | LDD0171 | [2] | |
|
IA-alkyne Probe Info |
 |
C64(0.89) | LDD2183 | [3] | |
Competitor(s) Related to This Target
| Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
|---|---|---|---|---|---|
| LDCM0026 | 4SU-RNA+native RNA | DM93 | C64(2.90) | LDD0171 | [2] |
| LDCM0630 | CCW28-3 | 231MFP | C64(1.26) | LDD2214 | [4] |
| LDCM0625 | F8 | Ramos | C64(0.78) | LDD2187 | [3] |
| LDCM0572 | Fragment10 | Ramos | C64(2.13) | LDD2189 | [3] |
| LDCM0574 | Fragment12 | Ramos | C64(1.62) | LDD2191 | [3] |
| LDCM0575 | Fragment13 | Ramos | C64(1.11) | LDD2192 | [3] |
| LDCM0576 | Fragment14 | Ramos | C64(1.03) | LDD2193 | [3] |
| LDCM0580 | Fragment21 | Ramos | C64(0.82) | LDD2195 | [3] |
| LDCM0582 | Fragment23 | Ramos | C64(1.36) | LDD2196 | [3] |
| LDCM0578 | Fragment27 | Ramos | C64(0.93) | LDD2197 | [3] |
| LDCM0588 | Fragment30 | Ramos | C64(0.72) | LDD2199 | [3] |
| LDCM0589 | Fragment31 | Ramos | C64(1.48) | LDD2200 | [3] |
| LDCM0590 | Fragment32 | Ramos | C64(2.39) | LDD2201 | [3] |
| LDCM0468 | Fragment33 | Ramos | C64(0.80) | LDD2202 | [3] |
| LDCM0596 | Fragment38 | Ramos | C64(0.94) | LDD2203 | [3] |
| LDCM0566 | Fragment4 | Ramos | C64(1.53) | LDD2184 | [3] |
| LDCM0610 | Fragment52 | Ramos | C64(1.07) | LDD2204 | [3] |
| LDCM0614 | Fragment56 | Ramos | C64(0.97) | LDD2205 | [3] |
| LDCM0569 | Fragment7 | Ramos | C64(3.17) | LDD2186 | [3] |
| LDCM0571 | Fragment9 | Ramos | C64(2.56) | LDD2188 | [3] |
| LDCM0023 | KB03 | Ramos | C64(0.89) | LDD2183 | [3] |
| LDCM0024 | KB05 | Ramos | C64(1.28) | LDD2185 | [3] |
The Interaction Atlas With This Target
References