Details of the Target
General Information of Target
| Target ID | LDTP03526 | |||||
|---|---|---|---|---|---|---|
| Target Name | High affinity immunoglobulin epsilon receptor subunit gamma (FCER1G) | |||||
| Gene Name | FCER1G | |||||
| Gene ID | 2207 | |||||
| Synonyms |
High affinity immunoglobulin epsilon receptor subunit gamma; Fc receptor gamma-chain; FcRgamma; Fc-epsilon RI-gamma; IgE Fc receptor subunit gamma; FceRI gamma |
|||||
| 3D Structure | ||||||
| Sequence |
MIPAVVLLLLLLVEQAAALGEPQLCYILDAILFLYGIVLTLLYCRLKIQVRKAAITSYEK
SDGVYTGLSTRNQETYETLKHEKPPQ |
|||||
| Target Type |
Successful
|
|||||
| Target Bioclass |
Other
|
|||||
| Family |
CD3Z/FCER1G family
|
|||||
| Subcellular location |
Cell membrane
|
|||||
| Function |
Adapter protein containing an immunoreceptor tyrosine-based activation motif (ITAM) that transduces activation signals from various immunoreceptors. As a component of the high-affinity immunoglobulin E (IgE) receptor, mediates allergic inflammatory signaling in mast cells. As a constitutive component of interleukin-3 receptor complex, selectively mediates interleukin 4/IL4 production by basophils, priming T-cells toward effector T-helper 2 subset. Associates with pattern recognition receptors CLEC4D and CLEC4E to form a functional signaling complex in myeloid cells. Binding of mycobacterial trehalose 6,6'-dimycolate (TDM) to this receptor complex leads to phosphorylation of ITAM, triggering activation of SYK, CARD9 and NF-kappa-B, consequently driving maturation of antigen-presenting cells and shaping antigen-specific priming of T-cells toward effector T-helper 1 and T-helper 17 cell subtypes. May function cooperatively with other activating receptors. Functionally linked to integrin beta-2/ITGB2-mediated neutrophil activation. Also involved in integrin alpha-2/ITGA2-mediated platelet activation.
|
|||||
| TTD ID | ||||||
| Uniprot ID | ||||||
| DrugMap ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
HPAP Probe Info |
![]() |
3.99 | LDD0064 | [1] | |
Competitor(s) Related to This Target
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Enzyme
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Tyrosine-protein kinase SYK (SYK) | Tyr protein kinase family | P43405 | |||
Immunoglobulin
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| CMRF35-like molecule 6 (CD300C) | CD300 family | Q08708 | |||
| High affinity immunoglobulin gamma Fc receptor I (FCGR1A) | Immunoglobulin superfamily | P12314 | |||
The Drug(s) Related To This Target
Approved
| Drug Name | Drug Type | External ID | |||
|---|---|---|---|---|---|
| Omalizumab | Monoclonal antibody | D02GEC | |||
| Benzylpenicilloyl Polylysine | Small molecular drug | D0J7TM | |||
| Benzylpenicilloyl Polylysine | Small molecular drug | DB00895 | |||
Investigative
| Drug Name | Drug Type | External ID | |||
|---|---|---|---|---|---|
| Alpha-d-mannose | Small molecular drug | D07LUR | |||
| Fucose | Small molecular drug | D0G6XS | |||

