Details of the Target
General Information of Target
| Target ID | LDTP03288 | |||||
|---|---|---|---|---|---|---|
| Target Name | Insulin-like growth factor-binding protein 5 (IGFBP5) |
|
||||
| Gene Name | IGFBP5 | |||||
| Gene ID | 3488 | |||||
| Synonyms |
IBP5; Insulin-like growth factor-binding protein 5; IBP-5; IGF-binding protein 5; IGFBP-5 |
|||||
| 3D Structure | ||||||
| Sequence |
MVLLTAVLLLLAAYAGPAQSLGSFVHCEPCDEKALSMCPPSPLGCELVKEPGCGCCMTCA
LAEGQSCGVYTERCAQGLRCLPRQDEEKPLHALLHGRGVCLNEKSYREQVKIERDSREHE EPTTSEMAEETYSPKIFRPKHTRISELKAEAVKKDRRKKLTQSKFVGGAENTAHPRIISA PEMRQESEQGPCRRHMEASLQELKASPRMVPRAVYLPNCDRKGFYKRKQCKPSRGRKRGI CWCVDKYGMKLPGMEYVDGDFQCHTFDSSNVE |
|||||
| Target Type |
Literature-reported
|
|||||
| Target Bioclass |
Other
|
|||||
| Subcellular location |
Secreted
|
|||||
| Function |
IGF-binding proteins prolong the half-life of the IGFs and have been shown to either inhibit or stimulate the growth promoting effects of the IGFs on cell culture. They alter the interaction of IGFs with their cell surface receptors.
|
|||||
| TTD ID | ||||||
| Uniprot ID | ||||||
| DrugMap ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
| ChEMBL ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
 |
C219(1.75) | LDD3345 | [1] | |
Competitor(s) Related to This Target
| Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
|---|---|---|---|---|---|
| LDCM0284 | AC24 | HEK-293T | C243(0.98) | LDD1523 | [2] |
| LDCM0293 | AC32 | HEK-293T | C243(0.87) | LDD1532 | [2] |
| LDCM0302 | AC40 | HEK-293T | C243(0.91) | LDD1541 | [2] |
| LDCM0310 | AC48 | HEK-293T | C243(0.85) | LDD1549 | [2] |
| LDCM0319 | AC56 | HEK-293T | C243(0.93) | LDD1558 | [2] |
| LDCM0328 | AC64 | HEK-293T | C243(0.88) | LDD1567 | [2] |
| LDCM0345 | AC8 | HEK-293T | C243(0.94) | LDD1569 | [2] |
| LDCM0275 | AKOS034007705 | HEK-293T | C243(1.15) | LDD1514 | [2] |
| LDCM0390 | CL12 | HEK-293T | C243(0.98) | LDD1594 | [2] |
| LDCM0412 | CL24 | HEK-293T | C243(1.05) | LDD1616 | [2] |
| LDCM0425 | CL36 | HEK-293T | C243(0.99) | LDD1629 | [2] |
| LDCM0438 | CL48 | HEK-293T | C243(1.15) | LDD1642 | [2] |
| LDCM0452 | CL60 | HEK-293T | C243(1.02) | LDD1655 | [2] |
| LDCM0465 | CL72 | HEK-293T | C243(1.13) | LDD1668 | [2] |
| LDCM0478 | CL84 | HEK-293T | C243(1.06) | LDD1681 | [2] |
| LDCM0491 | CL96 | HEK-293T | C243(1.01) | LDD1694 | [2] |
| LDCM0022 | KB02 | A2058 | C219(2.42); C100(1.90) | LDD2253 | [1] |
| LDCM0023 | KB03 | A2058 | C219(2.29); C100(2.08) | LDD2670 | [1] |
| LDCM0024 | KB05 | NCI-H1650 | C219(1.75) | LDD3345 | [1] |
References