Details of the Target
General Information of Target
| Target ID | LDTP03194 | |||||
|---|---|---|---|---|---|---|
| Target Name | Granulysin (GNLY) | |||||
| Gene Name | GNLY | |||||
| Gene ID | 10578 | |||||
| Synonyms |
LAG2; NKG5; TLA519; Granulysin; Lymphokine LAG-2; Protein NKG5; T-cell activation protein 519 |
|||||
| 3D Structure | ||||||
| Sequence |
MATWALLLLAAMLLGNPGLVFSRLSPEYYDLARAHLRDEEKSCPCLAQEGPQGDLLTKTQ
ELGRDYRTCLTIVQKLKKMVDKPTQRSVSNAATRVCRTGRSRWRDVCRNFMRRYQSRVTQ GLVAGETAQQICEDLRLCIPSTGPL |
|||||
| Target Bioclass |
Transporter and channel
|
|||||
| Subcellular location |
Secreted
|
|||||
| Function |
Antimicrobial protein that kills intracellular pathogens. Active against a broad range of microbes, including Gram-positive and Gram-negative bacteria, fungi, and parasites. Kills Mycobacterium tuberculosis.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
IA-alkyne Probe Info |
![]() |
C43, C45, C46(10.70) | LDD0528 | [1] | |
Competitor(s) Related to This Target

