Details of the Target
General Information of Target
| Target ID | LDTP03063 | |||||
|---|---|---|---|---|---|---|
| Target Name | Histone H2A type 1-D (H2AC7) | |||||
| Gene Name | H2AC7 | |||||
| Gene ID | 3013 | |||||
| Synonyms |
H2AFG; HIST1H2AD; Histone H2A type 1-D; Histone H2A.3; Histone H2A/g |
|||||
| 3D Structure | ||||||
| Sequence |
MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLT
AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKK TESHHKAKGK |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
Histone H2A family
|
|||||
| Subcellular location |
Nucleus
|
|||||
| Function |
Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
ILS-1 Probe Info |
 |
4.16 | LDD0415 | [1] | |
|
AZ-9 Probe Info |
 |
E92(1.09) | LDD2208 | [2] | |
References