Details of the Target
General Information of Target
| Target ID | LDTP02915 | |||||
|---|---|---|---|---|---|---|
| Target Name | Neuromodulin (GAP43) |
|
||||
| Gene Name | GAP43 | |||||
| Gene ID | 2596 | |||||
| Synonyms |
Neuromodulin; Axonal membrane protein GAP-43; Growth-associated protein 43; Neural phosphoprotein B-50; pp46 |
|||||
| 3D Structure | ||||||
| Sequence |
MLCCMRRTKQVEKNDDDQKIEQDGIKPEDKAHKAATKIQASFRGHITRKKLKGEKKDDVQ
AAEAEANKKDEAPVADGVEKKGEGTTTAEAAPATGSKPDEPGKAGETPSEEKKGEGDAAT EQAAPQAPASSEEKAGSAETESATKASTDNSPSSKAEDAPAKEEPKQADVPAAVTAAAAT TPAAEDAAAKATAQPPTETGESSQAEENIEAVDETKPKESARQDEGKEEEPEADQEHA |
|||||
| Target Type |
Literature-reported
|
|||||
| Target Bioclass |
Transporter and channel
|
|||||
| Family |
Neuromodulin family
|
|||||
| Subcellular location |
Cell membrane
|
|||||
| Function | This protein is associated with nerve growth. It is a major component of the motile 'growth cones' that form the tips of elongating axons. Plays a role in axonal and dendritic filopodia induction. | |||||
| TTD ID | ||||||
| Uniprot ID | ||||||
| DrugMap ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DAyne Probe Info |
 |
2.29 | LDD0261 | [1] | |
|
IA-alkyne Probe Info |
 |
N.A. | LDD0174 | [2] | |
|
VSF Probe Info |
 |
N.A. | LDD0007 | [3] | |
|
Phosphinate-6 Probe Info |
 |
N.A. | LDD0018 | [4] | |
The Interaction Atlas With This Target
References