Details of the Target

General Information of Target

Target ID LDTP02710
Target Name Glial fibrillary acidic protein (GFAP)
Gene Name GFAP
Gene ID 2670
Synonyms
Glial fibrillary acidic protein; GFAP
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MERRRITSAARRSYVSSGEMMVGGLAPGRRLGPGTRLSLARMPPPLPTRVDFSLAGALNA
GFKETRASERAEMMELNDRFASYIEKVRFLEQQNKALAAELNQLRAKEPTKLADVYQAEL
RELRLRLDQLTANSARLEVERDNLAQDLATVRQKLQDETNLRLEAENNLAAYRQEADEAT
LARLDLERKIESLEEEIRFLRKIHEEEVRELQEQLARQQVHVELDVAKPDLTAALKEIRT
QYEAMASSNMHEAEEWYRSKFADLTDAAARNAELLRQAKHEANDYRRQLQSLTCDLESLR
GTNESLERQMREQEERHVREAASYQEALARLEEEGQSLKDEMARHLQEYQDLLNVKLALD
IEIATYRKLLEGEENRITIPVQTFSNLQIRETSLDTKSVSEGHLKRNIVVKTVEMRDGEV
IKESKQEHKDVM
Target Type
Clinical trial
Target Bioclass
Other
Family
Intermediate filament family
Subcellular location
Cytoplasm
Function GFAP, a class-III intermediate filament, is a cell-specific marker that, during the development of the central nervous system, distinguishes astrocytes from other glial cells.
TTD ID
T63228
Uniprot ID
P14136
DrugMap ID
TTI6FFX
Ensemble ID
ENST00000435360.8
HGNC ID
HGNC:4235

Target Site Mutations in Different Cell Lines

Cell line Mutation details Probe for labeling this protein in this cell
MOLT4 SNV: p.Q325Ter; p.L387M .

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 2 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
AZ-9
 Probe Info  		E348(10.00); E91(0.98); D351(10.00)  LDD2208  [2]
DBIA
 Probe Info  		C294(1.31)  LDD2333  [3]
PAL-AfBPP Probe
Click To Hide/Show 2 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
DA-2
 Probe Info  		N.A.  LDD0073  [4]
STS-1
 Probe Info  		N.A.  LDD0068  [5]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0022  KB02 GAMG C294(1.31)  LDD2333  [3]
 LDCM0023  KB03 GAMG C294(1.33)  LDD2750  [3]
 LDCM0024  KB05 GAMG C294(1.13)  LDD3167  [3]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 28 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Aldehyde dehydrogenase 1A1 (ALDH1A1) Aldehyde dehydrogenase family P00352
Cell division cycle protein 23 homolog (CDC23) APC8/CDC23 family Q9UJX2
FAST kinase domain-containing protein 1, mitochondrial (FASTKD1) FAST kinase family Q53R41
Hyaluronidase-2 (HYAL2) Glycosyl hydrolase 56 family Q12891
Exostosin-like 2 (EXTL2) Glycosyltransferase 47 family Q9UBQ6
Baculoviral IAP repeat-containing protein 2 (BIRC2) IAP family Q13490
Phosphatidate phosphatase LPIN1 (LPIN1) Lipin family Q14693
[F-actin]-monooxygenase MICAL2 (MICAL2) Mical family O94851
Methionine-R-sulfoxide reductase B2, mitochondrial (MSRB2) MsrB Met sulfoxide reductase family Q9Y3D2
Transcriptional repressor NF-X1 (NFX1) NFX1 family Q12986
Protein N-terminal glutamine amidohydrolase (NTAQ1) NTAQ1 family Q96HA8
Cleavage and polyadenylation specificity factor subunit 5 (NUDT21) Nudix hydrolase family O43809
Ubiquitin carboxyl-terminal hydrolase 10 (USP10) Peptidase C19 family Q14694
Ubiquitin thioesterase OTUB1 (OTUB1) Peptidase C65 family Q96FW1
Proprotein convertase subtilisin/kexin type 7 (PCSK7) Peptidase S8 family Q16549
E3 SUMO-protein ligase PIAS2 (PIAS2) PIAS family O75928
Purine nucleoside phosphorylase (PNP) PNP/MTAP phosphorylase family P00491
Mitogen-activated protein kinase 9 (MAPK9) CMGC Ser/Thr protein kinase family P45984
Proto-oncogene serine/threonine-protein kinase mos (MOS) Ser/Thr protein kinase family P00540
Serine/threonine-protein kinase 36 (STK36) Ser/Thr protein kinase family Q9NRP7
Tyrosine-protein kinase Yes (YES1) Tyr protein kinase family P07947
Ras-related protein Rab-38 (RAB38) Rab family P57729
Ras-related protein Rab-5A (RAB5A) Rab family P20339
Thioredoxin (TXN) Thioredoxin family P10599
Zinc finger protein RFP (TRIM27) TRIM/RBCC family P14373
E3 ubiquitin-protein ligase LNX (LNX1) . Q8TBB1
LON peptidase N-terminal domain and RING finger protein 2 (LONRF2) . Q1L5Z9
Methyltransferase-like protein 27 (METTL27) . Q8N6F8
Transporter and channel
Click To Hide/Show 8 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
V-type proton ATPase subunit B, brain isoform (ATP6V1B2) ATPase alpha/beta chains family P21281
Hsp90 co-chaperone Cdc37 (CDC37) CDC37 family Q16543
Huntingtin (HTT) Huntingtin family P42858
Junctophilin-3 (JPH3) Junctophilin family Q8WXH2
Nuclear RNA export factor 1 (NXF1) NXF family Q9UBU9
p53 apoptosis effector related to PMP-22 (PERP) TMEM47 family Q96FX8
Membrane protein MLC1 (MLC1) . Q15049
Wolframin (WFS1) . O76024
Transcription factor
Click To Hide/Show 21 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
DNA damage-inducible transcript 3 protein (DDIT3) BZIP family P35638
Zinc finger protein ZFPM2 (ZFPM2) FOG (Friend of GATA) family Q8WW38
Protein Jade-3 (JADE3) JADE family Q92613
Zinc finger and SCAN domain-containing protein 22 (ZSCAN22) Krueppel C2H2-type zinc-finger protein family P10073
Zinc finger and SCAN domain-containing protein 9 (ZSCAN9) Krueppel C2H2-type zinc-finger protein family O15535
Zinc finger protein 19 (ZNF19) Krueppel C2H2-type zinc-finger protein family P17023
Zinc finger protein 20 (ZNF20) Krueppel C2H2-type zinc-finger protein family P17024
Zinc finger protein 232 (ZNF232) Krueppel C2H2-type zinc-finger protein family Q9UNY5
Zinc finger protein 436 (ZNF436) Krueppel C2H2-type zinc-finger protein family Q9C0F3
Zinc finger protein 500 (ZNF500) Krueppel C2H2-type zinc-finger protein family O60304
Zinc finger protein 572 (ZNF572) Krueppel C2H2-type zinc-finger protein family Q7Z3I7
Zinc finger protein 655 (ZNF655) Krueppel C2H2-type zinc-finger protein family Q8N720
Zinc finger protein 774 (ZNF774) Krueppel C2H2-type zinc-finger protein family Q6NX45
Zinc finger protein with KRAB and SCAN domains 3 (ZKSCAN3) Krueppel C2H2-type zinc-finger protein family Q9BRR0
Zinc finger protein with KRAB and SCAN domains 5 (ZKSCAN5) Krueppel C2H2-type zinc-finger protein family Q9Y2L8
NF-kappa-B inhibitor delta (NFKBID) NF-kappa-B inhibitor family Q8NI38
Nuclear receptor ROR-alpha (RORA) Nuclear hormone receptor family P35398
Visual system homeobox 2 (VSX2) Paired homeobox family P58304
PHD finger protein 19 (PHF19) Polycomblike family Q5T6S3
THAP domain-containing protein 1 (THAP1) THAP1 family Q9NVV9
Zinc finger protein 581 (ZNF581) . Q9P0T4
Immunoglobulin
Click To Hide/Show 2 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Myosin-binding protein H-like (MYBPHL) MyBP family A2RUH7
Platelet endothelial cell adhesion molecule (PECAM1) . P16284
Cytokine and receptor
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Cytokine receptor-like factor 3 (CRLF3) Cytokine receptor-like factor 3 family Q8IUI8
Other
Click To Hide/Show 85 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
BTB/POZ domain-containing adapter for CUL3-mediated RhoA degradation protein 2 (TNFAIP1) BACURD family Q13829
Catenin beta-1 (CTNNB1) Beta-catenin family P35222
Plakophilin-3 (PKP3) Beta-catenin family Q9Y446
Protein BRICK1 (BRK1) BRK1 family Q8WUW1
Cilia- and flagella-associated protein 206 (CFAP206) CFAP206 family Q8IYR0
CWF19-like protein 2 (CWF19L2) CWF19 family Q2TBE0
Cyclin-C (CCNC) Cyclin family P24863
Splicing factor ESS-2 homolog (ESS2) ESS2 family Q96DF8
Stabilizer of axonemal microtubules 1 (SAXO1) FAM154 family Q8IYX7
Protein FAM50B (FAM50B) FAM50 family Q9Y247
Golgin subfamily A member 2 (GOLGA2) GOLGA2 family Q08379
Histone H3.2 (H3C15; H3C14; H3C13) Histone H3 family Q71DI3
Desmin (DES) Intermediate filament family P17661
Glial fibrillary acidic protein (GFAP) Intermediate filament family P14136
Keratin, type I cuticular Ha1 (KRT31) Intermediate filament family Q15323
Keratin, type I cuticular Ha3-II (KRT33B) Intermediate filament family Q14525
Keratin, type I cytoskeletal 13 (KRT13) Intermediate filament family P13646
Keratin, type I cytoskeletal 15 (KRT15) Intermediate filament family P19012
Keratin, type I cytoskeletal 19 (KRT19) Intermediate filament family P08727
Keratin, type I cytoskeletal 27 (KRT27) Intermediate filament family Q7Z3Y8
Keratin, type I cytoskeletal 39 (KRT39) Intermediate filament family Q6A163
Neurofilament light polypeptide (NEFL) Intermediate filament family P07196
Syncoilin (SYNC) Intermediate filament family Q9H7C4
Vimentin (VIM) Intermediate filament family P08670
Na(+)/H(+) exchange regulatory cofactor NHE-RF3 (PDZK1) NHER family Q5T2W1
Nucleosome assembly protein 1-like 3 (NAP1L3) Nucleosome assembly protein (NAP) family Q99457
Protein CIMAP1D (CIMAP1D) ODF3 family Q3SX64
PIH1 domain-containing protein 2 (PIH1D2) PIH1 family Q8WWB5
Paraneoplastic antigen-like protein 5 (PNMA5) PNMA family Q96PV4
Rhophilin-1 (RHPN1) RHPN family Q8TCX5
SH3 domain-containing YSC84-like protein 1 (SH3YL1) SH3YL1 family Q96HL8
Pre-mRNA-splicing factor SLU7 (SLU7) SLU7 family O95391
SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 1 (SMARCD1) SMARCD family Q96GM5
SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 (SMARCB1) SNF5 family Q12824
SNW domain-containing protein 1 (SNW1) SNW family Q13573
Spermatogenesis-associated protein 2 (SPATA2) SPATA2 family Q9UM82
Spermatogenesis-associated protein 2-like protein (SPATA2L) SPATA2 family Q8IUW3
Pre-mRNA-splicing factor SPF27 (BCAS2) SPF27 family O75934
Protein TASOR 2 (TASOR2) TASOR family Q5VWN6
Tuftelin-interacting protein 11 (TFIP11) TFP11/STIP family Q9UBB9
Transmembrane protein 186 (TMEM186) TMEM186 family Q96B77
Translin-associated protein X (TSNAX) Translin family Q99598
TLE family member 5 (TLE5) WD repeat Groucho/TLE family Q08117
WD repeat domain-containing protein 83 (WDR83) WD repeat MORG1 family Q9BRX9
Zinc finger C2HC domain-containing protein 1C (ZC2HC1C) ZC2HC1 family Q53FD0
Bromo adjacent homology domain-containing 1 protein (BAHD1) . Q8TBE0
Cancer/testis antigen 55 (CT55) . Q8WUE5
Caspase recruitment domain-containing protein 10 (CARD10) . Q9BWT7
Coiled-coil domain-containing protein 120 (CCDC120) . Q96HB5
Enkurin domain-containing protein 1 (ENKD1) . Q9H0I2
EPM2A-interacting protein 1 (EPM2AIP1) . Q7L775
Fanconi anemia group G protein (FANCG) . O15287
Galectin-9C (LGALS9C) . Q6DKI2
Heterogeneous nuclear ribonucleoprotein K (HNRNPK) . P61978
IQ motif and ubiquitin-like domain-containing protein (IQUB) . Q8NA54
Kelch-like protein 20 (KLHL20) . Q9Y2M5
Leukocyte receptor cluster member 1 (LENG1) . Q96BZ8
Leukocyte receptor cluster member 8 (LENG8) . Q96PV6
Microspherule protein 1 (MCRS1) . Q96EZ8
Myosin regulatory light chain 11 (MYL11) . Q96A32
Nebulette (NEBL) . O76041
Nucleotide-binding oligomerization domain-containing protein 1 (NOD1) . Q9Y239
PDZ and LIM domain protein 1 (PDLIM1) . O00151
PDZ and LIM domain protein 5 (PDLIM5) . Q96HC4
Period circadian protein homolog 1 (PER1) . O15534
Phostensin (PPP1R18) . Q6NYC8
Placental protein 13-like (LGALS14) . Q8TCE9
Protein DBF4 homolog A (DBF4) . Q9UBU7
Protein phosphatase 1 regulatory inhibitor subunit 16B (PPP1R16B) . Q96T49
Protein phosphatase 1 regulatory subunit 16A (PPP1R16A) . Q96I34
Ras association domain-containing protein 2 (RASSF2) . P50749
Rhombotin-2 (LMO2) . P25791
RING1 and YY1-binding protein (RYBP) . Q8N488
RUN and FYVE domain-containing protein 4 (RUFY4) . Q6ZNE9
Spermatogenesis-associated protein 22 (SPATA22) . Q8NHS9
Sprouty-related, EVH1 domain-containing protein 1 (SPRED1) . Q7Z699
Sprouty-related, EVH1 domain-containing protein 2 (SPRED2) . Q7Z698
Superkiller complex protein 8 (SKIC8) . Q9GZS3
TBC1 domain family member 21 (TBC1D21) . Q8IYX1
TBC1 domain family member 22B (TBC1D22B) . Q9NU19
Telethonin (TCAP) . O15273
U5 small nuclear ribonucleoprotein 40 kDa protein (SNRNP40) . Q96DI7
UBX domain-containing protein 8 (UBXN8) . O00124
Uncharacterized protein C6orf141 (C6orf141) . Q5SZD1
Uncharacterized protein KIAA0408 (KIAA0408) . Q6ZU52

References

1 Labeling Preferences of Diazirines with Protein Biomolecules. J Am Chem Soc. 2021 May 5;143(17):6691-6700. doi: 10.1021/jacs.1c02509. Epub 2021 Apr 20.
Mass spectrometry data entry: PXD025140
2 2H-Azirine-Based Reagents for Chemoselective Bioconjugation at Carboxyl Residues Inside Live Cells. J Am Chem Soc. 2020 Apr 1;142(13):6051-6059. doi: 10.1021/jacs.9b12116. Epub 2020 Mar 23.
3 DrugMap: A quantitative pan-cancer analysis of cysteine ligandability. Cell. 2024 May 9;187(10):2536-2556.e30. doi: 10.1016/j.cell.2024.03.027. Epub 2024 Apr 22.
Mass spectrometry data entry: PXD047840
4 Cell-based proteome profiling of potential dasatinib targets by use of affinity-based probes. J Am Chem Soc. 2012 Feb 15;134(6):3001-14. doi: 10.1021/ja208518u. Epub 2012 Feb 1.
5 Proteome profiling reveals potential cellular targets of staurosporine using a clickable cell-permeable probe. Chem Commun (Camb). 2011 Oct 28;47(40):11306-8. doi: 10.1039/c1cc14824a. Epub 2011 Sep 16.