Details of the Target
General Information of Target
| Target ID | LDTP02658 | |||||
|---|---|---|---|---|---|---|
| Target Name | Cytochrome b-245 light chain (CYBA) | |||||
| Gene Name | CYBA | |||||
| Gene ID | 1535 | |||||
| Synonyms |
Cytochrome b-245 light chain; Cytochrome b(558) alpha chain; Cytochrome b558 subunit alpha; Neutrophil cytochrome b 22 kDa polypeptide; Superoxide-generating NADPH oxidase light chain subunit; p22 phagocyte B-cytochrome; p22-phox; p22phox
|
|||||
| 3D Structure | ||||||
| Sequence |
MGQIEWAMWANEQALASGLILITGGIVATAGRFTQWYFGAYSIVAGVFVCLLEYPRGKRK
KGSTMERWGQKYMTAVVKLFGPFTRNYYVRAVLHLLLSVPAGFLLATILGTACLAIASGI YLLAAVRGEQWTPIEPKPRERPQIGGTIKQPPSNPPPRPPAEARKKPSEEEAAVAAGGPP GGPQVNPIPVTDEVV |
|||||
| Target Bioclass |
Transporter and channel
|
|||||
| Family |
P22phox family
|
|||||
| Subcellular location |
Cell membrane
|
|||||
| Function | Critical component of the membrane-bound oxidase of phagocytes that generates superoxide. Associates with NOX3 to form a functional NADPH oxidase constitutively generating superoxide. | |||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
CHEMBL5175495 Probe Info |
![]() |
6.50 | LDD0196 | [1] | |
|
Alkyne-RA190 Probe Info |
![]() |
2.79 | LDD0299 | [2] | |
|
AOyne Probe Info |
![]() |
15.00 | LDD0443 | [3] | |
Competitor(s) Related to This Target
The Interaction Atlas With This Target
References



