Details of the Target

General Information of Target

Target ID LDTP02593
Target Name B-cell antigen receptor complex-associated protein alpha chain (CD79A)
Gene Name CD79A
Gene ID 973
Synonyms
IGA; MB1; B-cell antigen receptor complex-associated protein alpha chain; Ig-alpha; MB-1 membrane glycoprotein; Membrane-bound immunoglobulin-associated protein; Surface IgM-associated protein; CD antigen CD79a
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MPGGPGVLQALPATIFLLFLLSAVYLGPGCQALWMHKVPASLMVSLGEDAHFQCPHNSSN
NANVTWWRVLHGNYTWPPEFLGPGEDPNGTLIIQNVNKSHGGIYVCRVQEGNESYQQSCG
TYLRVRQPPPRPFLDMGEGTKNRIITAEGIILLFCAVVPGTLLLFRKRWQNEKLGLDAGD
EYEDENLYEGLNLDDCSMYEDISRGLQGTYQDVGSLNIGDVQLEKP
Target Bioclass
Immunoglobulin
Subcellular location
Cell membrane
Function
Required in cooperation with CD79B for initiation of the signal transduction cascade activated by binding of antigen to the B-cell antigen receptor complex (BCR) which leads to internalization of the complex, trafficking to late endosomes and antigen presentation. Also required for BCR surface expression and for efficient differentiation of pro- and pre-B-cells. Stimulates SYK autophosphorylation and activation. Binds to BLNK, bringing BLNK into proximity with SYK and allowing SYK to phosphorylate BLNK. Also interacts with and increases activity of some Src-family tyrosine kinases. Represses BCR signaling during development of immature B-cells.
Uniprot ID
P11912
Ensemble ID
ENST00000221972.8
HGNC ID
HGNC:1698

Target Site Mutations in Different Cell Lines

Cell line Mutation details Probe for labeling this protein in this cell
G361 SNV: p.E148G DBIA    Probe Info 
MDAMB231 SNV: p.C106Y .
MEWO SNV: p.D135N .
MOLT4 SNV: p.D86N .
NCIH1793 SNV: p.Y188F .
TOV21G Deletion: p.R131GfsTer61 .

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 2 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
DBIA
 Probe Info  		C106(2.80)  LDD3419  [1]
IA-alkyne
 Probe Info  		13.08  LDD0431  [2]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0625  F8 Ramos C106(1.51); C119(1.49)  LDD2187  [3]
 LDCM0572  Fragment10 Ramos C119(1.78)  LDD2189  [3]
 LDCM0573  Fragment11 Ramos C106(2.21); C119(0.47)  LDD2190  [3]
 LDCM0574  Fragment12 Ramos C119(1.63)  LDD2191  [3]
 LDCM0575  Fragment13 Ramos C119(1.15)  LDD2192  [3]
 LDCM0576  Fragment14 Ramos C119(1.21)  LDD2193  [3]
 LDCM0579  Fragment20 Ramos C119(2.49)  LDD2194  [3]
 LDCM0580  Fragment21 Ramos C119(0.95)  LDD2195  [3]
 LDCM0582  Fragment23 Ramos C119(0.92)  LDD2196  [3]
 LDCM0578  Fragment27 Ramos C119(1.02)  LDD2197  [3]
 LDCM0586  Fragment28 Ramos C106(1.06); C119(0.80)  LDD2198  [3]
 LDCM0588  Fragment30 Ramos C106(1.99); C119(1.38)  LDD2199  [3]
 LDCM0589  Fragment31 Ramos C106(1.29); C119(1.10)  LDD2200  [3]
 LDCM0468  Fragment33 Ramos C106(1.25); C119(1.40)  LDD2202  [3]
 LDCM0596  Fragment38 Ramos C119(1.00)  LDD2203  [3]
 LDCM0566  Fragment4 Ramos C106(1.53); C119(2.07)  LDD2184  [3]
 LDCM0610  Fragment52 Ramos C119(1.68)  LDD2204  [3]
 LDCM0614  Fragment56 Ramos C119(1.55)  LDD2205  [3]
 LDCM0569  Fragment7 Ramos C106(2.21); C119(1.02)  LDD2186  [3]
 LDCM0022  KB02 Ramos 13.08  LDD0431  [2]
 LDCM0023  KB03 Ramos C106(2.09); C119(1.24)  LDD2183  [3]
 LDCM0024  KB05 SH-4 C106(2.80)  LDD3419  [1]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 35 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Inactive pancreatic lipase-related protein 1 (PNLIPRP1) Lipase family P54315
Dol-P-Glc:Glc(2)Man(9)GlcNAc(2)-PP-Dol alpha-1,2-glucosyltransferase (ALG10) ALG10 glucosyltransferase family Q5BKT4
Putative Dol-P-Glc:Glc(2)Man(9)GlcNAc(2)-PP-Dol alpha-1,2-glucosyltransferase (ALG10B) ALG10 glucosyltransferase family Q5I7T1
N-acetyltransferase 8 (NAT8) Camello family Q9UHE5
CDP-diacylglycerol--inositol 3-phosphatidyltransferase (CDIPT) CDP-alcohol phosphatidyltransferase class-I family O14735
Cytochrome b5 type B (CYB5B) Cytochrome b5 family O43169
Palmitoyltransferase ZDHHC15 (ZDHHC15) DHHC palmitoyltransferase family Q96MV8
Palmitoyltransferase ZDHHC22 (ZDHHC22) DHHC palmitoyltransferase family Q8N966
Sialidase-1 (NEU1) Glycosyl hydrolase 33 family Q99519
Polypeptide N-acetylgalactosaminyltransferase 15 (GALNT15) Glycosyltransferase 2 family Q8N3T1
Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase (ALG3) Glycosyltransferase 58 family Q92685
Heme oxygenase 1 (HMOX1) Heme oxygenase family P09601
Heme oxygenase 2 (HMOX2) Heme oxygenase family P30519
Leukotriene C4 synthase (LTC4S) MAPEG family Q16873
Transmembrane protein with metallophosphoesterase domain (TMPPE) LOC643853 family Q6ZT21
Phospholipid phosphatase-related protein type 2 (PLPPR2) PA-phosphatase related phosphoesterase family Q96GM1
Polyisoprenoid diphosphate/phosphate phosphohydrolase PLPP6 (PLPP6) PA-phosphatase related phosphoesterase family Q8IY26
Squalene synthase (FDFT1) Phytoene/squalene synthase family P37268
Dolichol kinase (DOLK) Polyprenol kinase family Q9UPQ8
Very-long-chain enoyl-CoA reductase (TECR) Steroid 5-alpha reductase family Q9NZ01
Fatty acid hydroxylase domain-containing protein 2 (FAXDC2) Sterol desaturase family Q96IV6
Fatty acid 2-hydroxylase (FA2H) Sterol desaturase family Q7L5A8
Lysoplasmalogenase TMEM86A (TMEM86A) TMEM86 family Q8N2M4
Lysoplasmalogenase TMEM86B (TMEM86B) TMEM86 family Q8N661
GTPase IMAP family member 1 (GIMAP1) AIG1/Toc34/Toc159-like paraseptin GTPase family Q8WWP7
UbiA prenyltransferase domain-containing protein 1 (UBIAD1) UbiA prenyltransferase family Q9Y5Z9
Ubiquitin-conjugating enzyme E2 J1 (UBE2J1) Ubiquitin-conjugating enzyme family Q9Y385
V-type proton ATPase 16 kDa proteolipid subunit c (ATP6V0C) V-ATPase proteolipid subunit family P27449
Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 4 (HACD4) Very long-chain fatty acids dehydratase HACD family Q5VWC8
E3 ubiquitin-protein ligase MARCHF2 (MARCHF2) . Q9P0N8
Lysosomal membrane ascorbate-dependent ferrireductase CYB561A3 (CYB561A3) . Q8NBI2
Peptidyl-prolyl cis-trans isomerase FKBP8 (FKBP8) . Q14318
Phosphatidylinositol-3-phosphatase SAC1 (SACM1L) . Q9NTJ5
Transmembrane ascorbate-dependent reductase CYB561 (CYB561) . P49447
Transmembrane reductase CYB561D2 (CYB561D2) . O14569
Transporter and channel
Click To Hide/Show 55 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
High affinity cationic amino acid transporter 1 (SLC7A1) Cationic amino acid transporter (CAT) (TC 2.A.3.3) family P30825
Sodium-coupled neutral amino acid symporter 1 (SLC38A1) Amino acid/polyamine transporter 2 family Q9H2H9
Bcl-2-like protein 2 (BCL2L2) Bcl-2 family Q92843
Bax inhibitor 1 (TMBIM6) BI1 family P55061
Proton-coupled zinc antiporter SLC30A2 (SLC30A2) Cation diffusion facilitator (CDF) transporter (TC 2.A.4) family Q9BRI3
Claudin-1 (CLDN1) Claudin family O95832
Gap junction beta-1 protein (GJB1) Connexin family P08034
Protein cornichon homolog 1 (CNIH1) Cornichon family O95406
Protein cornichon homolog 3 (CNIH3) Cornichon family Q8TBE1
ER membrane protein complex subunit 6 (EMC6) EMC6 family Q9BV81
Insulin-induced gene 2 protein (INSIG2) INSIG family Q9Y5U4
Transmembrane 4 L6 family member 19 (TM4SF19) L6 tetraspanin family Q96DZ7
Transmembrane 4 L6 family member 4 (TM4SF4) L6 tetraspanin family P48230
LHFPL tetraspan subfamily member 5 protein (LHFPL5) LHFP family Q8TAF8
Molybdate-anion transporter (MFSD5) Major facilitator superfamily Q6N075
Major facilitator superfamily domain-containing protein 6 (MFSD6) MFSD6 family Q6ZSS7
Monocarboxylate transporter 12 (SLC16A12) Monocarboxylate porter (TC 2.A.1.13) family Q6ZSM3
Monocarboxylate transporter 13 (SLC16A13) Monocarboxylate porter (TC 2.A.1.13) family Q7RTY0
Myeloid-associated differentiation marker (MYADM) MAL family Q96S97
Aquaporin-1 (AQP1) MIP/aquaporin (TC 1.A.8) family P29972
Aquaporin-3 (AQP3) MIP/aquaporin (TC 1.A.8) family Q92482
Membrane-spanning 4-domains subfamily A member 13 (MS4A13) MS4A family Q5J8X5
NIPA-like protein 3 (NIPAL3) NIPA family Q6P499
Nucleotide sugar transporter SLC35B4 (SLC35B4) Nucleotide-sugar transporter family Q969S0
Solute carrier family 35 member B1 (SLC35B1) Nucleotide-sugar transporter family P78383
Proton channel OTOP2 (OTOP2) Otopetrin family Q7RTS6
PRA1 family protein 2 (PRAF2) PRA1 family O60831
Na(+)/citrate cotransporter (SLC13A5) SLC13A/DASS transporter family Q86YT5
Solute carrier family 13 member 4 (SLC13A4) SLC13A/DASS transporter family Q9UKG4
Solute carrier family 41 member 1 (SLC41A1) SLC41A transporter family Q8IVJ1
Solute carrier family 41 member 2 (SLC41A2) SLC41A transporter family Q96JW4
Sodium- and chloride-dependent betaine transporter (SLC6A12) Sodium:neurotransmitter symporter (SNF) (TC 2.A.22) family P48065
Vesicle-associated membrane protein 3 (VAMP3) Synaptobrevin family Q15836
Syntaxin-3 (STX3) Syntaxin family Q13277
Transmembrane protein 14B (TMEM14B) TMEM14 family Q9NUH8
BOS complex subunit TMEM147 (TMEM147) TMEM147 family Q9BVK8
Transmembrane protein 176A (TMEM176A) TMEM176 family Q96HP8
Transmembrane protein 218 (TMEM218) TMEM218 family A2RU14
Translocating chain-associated membrane protein 1-like 1 (TRAM1L1) TRAM family Q8N609
Translocator protein 2 (TSPO2) TspO/BZRP family Q5TGU0
Protein unc-93 homolog B1 (UNC93B1) Unc-93 family Q9H1C4
Vesicle-associated membrane protein-associated protein A (VAPA) VAMP-associated protein (VAP) (TC 9.B.17) family Q9P0L0
Vesicle-associated membrane protein-associated protein B/C (VAPB) VAMP-associated protein (VAP) (TC 9.B.17) family O95292
Vesicle transport through interaction with t-SNAREs homolog 1B (VTI1B) VTI1 family Q9UEU0
Zinc transporter ZIP2 (SLC39A2) ZIP transporter (TC 2.A.5) family Q9NP94
Zinc transporter ZIP9 (SLC39A9) ZIP transporter (TC 2.A.5) family Q9NUM3
Adiponectin (ADIPOQ) . Q15848
Ceroid-lipofuscinosis neuronal protein 6 (CLN6) . Q9NWW5
Phospholipid transfer protein C2CD2L (C2CD2L) . O14523
Proteolipid protein 2 (PLP2) . Q04941
Sarcoplasmic/endoplasmic reticulum calcium ATPase regulator DWORF (STRIT1) . P0DN84
Solute carrier family 66 member 2 (SLC66A2) . Q8N2U9
Synaptojanin-2-binding protein (SYNJ2BP) . P57105
Transmembrane protein 187 (TMEM187) . Q14656
Wolframin (WFS1) . O76024
GPCR
Click To Hide/Show 4 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Free fatty acid receptor 3 (FFAR3) G-protein coupled receptor 1 family O14843
G-protein coupled receptor 42 (GPR42) G-protein coupled receptor 1 family O15529
Lysophosphatidic acid receptor 3 (LPAR3) G-protein coupled receptor 1 family Q9UBY5
Rhodopsin (RHO) G-protein coupled receptor 1 family P08100
Immunoglobulin
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Butyrophilin subfamily 2 member A2 (BTN2A2) BTN/MOG family Q8WVV5
Cytokine and receptor
Click To Hide/Show 2 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
CKLF-like MARVEL transmembrane domain-containing protein 7 (CMTM7) Chemokine-like factor family Q96FZ5
Tumor necrosis factor receptor superfamily member 10C (TNFRSF10C) . O14798
Other
Click To Hide/Show 46 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
BET1 homolog (BET1) BET1 family O15155
Beta-defensin 127 (DEFB127) Beta-defensin family Q9H1M4
Apolipoprotein D (APOD) Lipocalin family P05090
Cortexin-3 (CTXN3) Cortexin family Q4LDR2
FUN14 domain-containing protein 2 (FUNDC2) FUN14 family Q9BWH2
Radiation-inducible immediate-early gene IEX-1 (IER3) IER3 family P46695
Integrin alpha-M (ITGAM) Integrin alpha chain family P11215
Protein jagunal homolog 1 (JAGN1) Jagunal family Q8N5M9
MAL-like protein (MALL) MAL family Q13021
Myeloid-associated differentiation marker-like protein 2 (MYADML2) MAL family A6NDP7
Ninjurin-2 (NINJ2) Ninjurin family Q9NZG7
Leptin receptor overlapping transcript-like 1 (LEPROTL1) OB-RGRP/VPS55 family O95214
ORM1-like protein 2 (ORMDL2) ORM family Q53FV1
Epithelial membrane protein 1 (EMP1) PMP-22/EMP/MP20 family P54849
Epithelial membrane protein 3 (EMP3) PMP-22/EMP/MP20 family P54852
Protein NKG7 (NKG7) PMP-22/EMP/MP20 family Q16617
Stress-associated endoplasmic reticulum protein 1 (SERP1) RAMP4 family Q9Y6X1
Single-pass membrane and coiled-coil domain-containing protein 4 (SMCO4) SMCO4 family Q9NRQ5
Vesicle-trafficking protein SEC22b (SEC22B) Synaptobrevin family O75396
Syntaxin-12 (STX12) Syntaxin family Q86Y82
Syntaxin-8 (STX8) Syntaxin family Q9UNK0
Tetraspanin-2 (TSPAN2) Tetraspanin (TM4SF) family O60636
Transmembrane protein 11, mitochondrial (TMEM11) TMEM11 family P17152
Transmembrane protein 19 (TMEM19) TMEM19 family Q96HH6
Transmembrane protein 229B (TMEM229B) TMEM229 family Q8NBD8
Transmembrane protein 243 (TMEM243) TMEM243 family Q9BU79
Receptor-transporting protein 2 (RTP2) TMEM7 family Q5QGT7
Protein YIF1A (YIF1A) YIF1 family O95070
Protein YIPF4 (YIPF4) YIP1 family Q9BSR8
Protein YIPF6 (YIPF6) YIP1 family Q96EC8
Cation channel sperm-associated auxiliary subunit TMEM262 (TMEM262) . E9PQX1
Coiled-coil domain-containing protein 167 (CCDC167) . Q9P0B6
Epididymal secretory protein E3-beta (EDDM3B) . P56851
Fetal and adult testis-expressed transcript protein (FATE1) . Q969F0
Laminin subunit beta-1 (LAMB1) . P07942
Motile sperm domain-containing protein 3 (MOSPD3) . O75425
Nutritionally-regulated adipose and cardiac enriched protein homolog (NRAC) . Q8N912
Pulmonary surfactant-associated protein C (SFTPC) . P11686
Small integral membrane protein 3 (SMIM3) . Q9BZL3
Thrombomodulin (THBD) . P07204
Transmembrane protein 107 (TMEM107) . Q6UX40
Transmembrane protein 140 (TMEM140) . Q9NV12
Transmembrane protein 222 (TMEM222) . Q9H0R3
Transmembrane protein 254 (TMEM254) . Q8TBM7
Transmembrane protein 42 (TMEM42) . Q69YG0
WAP four-disulfide core domain protein 2 (WFDC2) . Q14508

References

1 DrugMap: A quantitative pan-cancer analysis of cysteine ligandability. Cell. 2024 May 9;187(10):2536-2556.e30. doi: 10.1016/j.cell.2024.03.027. Epub 2024 Apr 22.
Mass spectrometry data entry: PXD047840
2 2-Sulfonylpyridines as Tunable, Cysteine-Reactive Electrophiles. J Am Chem Soc. 2020 May 13;142(19):8972-8979. doi: 10.1021/jacs.0c02721. Epub 2020 Apr 29.
3 Site-specific quantitative cysteine profiling with data-independent acquisition-based mass spectrometry. Methods Enzymol. 2023;679:295-322. doi: 10.1016/bs.mie.2022.07.037. Epub 2022 Sep 7.
Mass spectrometry data entry: PXD027578