Details of the Target
General Information of Target
Target ID | LDTP02489 | |||||
---|---|---|---|---|---|---|
Target Name | Retinoic acid receptor alpha (RARA) | |||||
Gene Name | RARA | |||||
Gene ID | 5914 | |||||
Synonyms |
NR1B1; Retinoic acid receptor alpha; RAR-alpha; Nuclear receptor subfamily 1 group B member 1 |
|||||
3D Structure | ||||||
Sequence |
MASNSSSCPTPGGGHLNGYPVPPYAFFFPPMLGGLSPPGALTTLQHQLPVSGYSTPSPAT
IETQSSSSEEIVPSPPSPPPLPRIYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNM VYTCHRDKNCIINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKEVPKPECSESYTL TPEVGELIEKVRKAHQETFPALCQLGKYTTNNSSEQRVSLDIDLWDKFSELSTKCIIKTV EFAKQLPGFTTLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNA GFGPLTDLVFAFANQLLPLEMDDAETGLLSAICLICGDRQDLEQPDRVDMLQEPLLEALK VYVRKRRPSRPHMFPKMLMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGL DTLSGQPGGGGRDGGGLAPPPGSCSPSLSPSSNRSSPATHSP |
|||||
Target Type |
Clinical trial
|
|||||
Target Bioclass |
Transcription factor
|
|||||
Family |
Nuclear hormone receptor family, NR1 subfamily
|
|||||
Subcellular location |
Nucleus
|
|||||
Function |
Receptor for retinoic acid. Retinoic acid receptors bind as heterodimers to their target response elements in response to their ligands, all-trans or 9-cis retinoic acid, and regulate gene expression in various biological processes. The RXR/RAR heterodimers bind to the retinoic acid response elements (RARE) composed of tandem 5'-AGGTCA-3' sites known as DR1-DR5. In the absence of ligand, the RXR-RAR heterodimers associate with a multiprotein complex containing transcription corepressors that induce histone deacetylation, chromatin condensation and transcriptional suppression. On ligand binding, the corepressors dissociate from the receptors and associate with the coactivators leading to transcriptional activation. Formation of a complex with histone deacetylases might lead to inhibition of RARE DNA element binding and to transcriptional repression. Transcriptional activation and RARE DNA element binding might be supported by the transcription factor KLF2. RARA plays an essential role in the regulation of retinoic acid-induced germ cell development during spermatogenesis. Has a role in the survival of early spermatocytes at the beginning prophase of meiosis. In Sertoli cells, may promote the survival and development of early meiotic prophase spermatocytes. In concert with RARG, required for skeletal growth, matrix homeostasis and growth plate function. Together with RXRA, positively regulates microRNA-10a expression, thereby inhibiting the GATA6/VCAM1 signaling response to pulsatile shear stress in vascular endothelial cells. In association with HDAC3, HDAC5 and HDAC7 corepressors, plays a role in the repression of microRNA-10a and thereby promotes the inflammatory response.
|
|||||
TTD ID | ||||||
Uniprot ID | ||||||
DrugMap ID | ||||||
Ensemble ID | ||||||
HGNC ID | ||||||
ChEMBL ID |
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
---|---|---|---|---|---|
IPM Probe Info |
![]() |
C203(1.06) | LDD1702 | [1] | |
BDBM50514113 Probe Info |
![]() |
2.24 | LDD0041 | [2] | |
DBIA Probe Info |
![]() |
C174(0.84) | LDD1511 | [3] | |
IA-alkyne Probe Info |
![]() |
C148(0.00); C124(0.00) | LDD0165 | [4] | |
NAIA_5 Probe Info |
![]() |
N.A. | LDD2223 | [5] |
Competitor(s) Related to This Target
Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
---|---|---|---|---|---|
LDCM0259 | AC14 | HEK-293T | C265(1.18) | LDD1512 | [3] |
LDCM0281 | AC21 | HEK-293T | C174(0.88) | LDD1520 | [3] |
LDCM0282 | AC22 | HEK-293T | C265(0.90) | LDD1521 | [3] |
LDCM0289 | AC29 | HEK-293T | C174(0.95) | LDD1528 | [3] |
LDCM0291 | AC30 | HEK-293T | C265(1.13) | LDD1530 | [3] |
LDCM0298 | AC37 | HEK-293T | C174(0.88) | LDD1537 | [3] |
LDCM0299 | AC38 | HEK-293T | C265(0.95) | LDD1538 | [3] |
LDCM0307 | AC45 | HEK-293T | C174(0.86) | LDD1546 | [3] |
LDCM0308 | AC46 | HEK-293T | C265(1.16) | LDD1547 | [3] |
LDCM0312 | AC5 | HEK-293T | C174(0.90) | LDD1551 | [3] |
LDCM0316 | AC53 | HEK-293T | C174(0.83) | LDD1555 | [3] |
LDCM0317 | AC54 | HEK-293T | C265(0.95) | LDD1556 | [3] |
LDCM0323 | AC6 | HEK-293T | C265(1.16) | LDD1562 | [3] |
LDCM0325 | AC61 | HEK-293T | C174(0.80) | LDD1564 | [3] |
LDCM0326 | AC62 | HEK-293T | C265(0.99) | LDD1565 | [3] |
LDCM0248 | AKOS034007472 | HEK-293T | C174(0.84) | LDD1511 | [3] |
LDCM0632 | CL-Sc | Hep-G2 | C203(0.88) | LDD2227 | [5] |
LDCM0368 | CL10 | HEK-293T | C265(1.10) | LDD1572 | [3] |
LDCM0409 | CL21 | HEK-293T | C174(0.90) | LDD1613 | [3] |
LDCM0410 | CL22 | HEK-293T | C265(1.45) | LDD1614 | [3] |
LDCM0422 | CL33 | HEK-293T | C174(0.99) | LDD1626 | [3] |
LDCM0423 | CL34 | HEK-293T | C265(1.26) | LDD1627 | [3] |
LDCM0435 | CL45 | HEK-293T | C174(0.91) | LDD1639 | [3] |
LDCM0436 | CL46 | HEK-293T | C265(1.09) | LDD1640 | [3] |
LDCM0448 | CL57 | HEK-293T | C174(0.99) | LDD1651 | [3] |
LDCM0449 | CL58 | HEK-293T | C265(1.27) | LDD1652 | [3] |
LDCM0461 | CL69 | HEK-293T | C174(0.97) | LDD1664 | [3] |
LDCM0463 | CL70 | HEK-293T | C265(1.36) | LDD1666 | [3] |
LDCM0475 | CL81 | HEK-293T | C174(0.84) | LDD1678 | [3] |
LDCM0476 | CL82 | HEK-293T | C265(1.25) | LDD1679 | [3] |
LDCM0484 | CL9 | HEK-293T | C174(0.91) | LDD1687 | [3] |
LDCM0488 | CL93 | HEK-293T | C174(0.96) | LDD1691 | [3] |
LDCM0489 | CL94 | HEK-293T | C265(1.40) | LDD1692 | [3] |
LDCM0213 | Electrophilic fragment 2 | MDA-MB-231 | C203(1.06) | LDD1702 | [1] |
LDCM0002 | Ward_cp1 | U2OS | 2.24 | LDD0041 | [2] |
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Enzyme
Transporter and channel
Protein name | Family | Uniprot ID | |||
---|---|---|---|---|---|
Bardet-Biedl syndrome 4 protein (BBS4) | BBS4 family | Q96RK4 | |||
Beclin-1 (BECN1) | Beclin family | Q14457 | |||
Optineurin (OPTN) | . | Q96CV9 |
Transcription factor
Other
The Drug(s) Related To This Target
Approved
Phase 3
Drug Name | Drug Type | External ID | |||
---|---|---|---|---|---|
Tamibarotene | Small molecular drug | D02GTY |
Phase 1
Drug Name | Drug Type | External ID | |||
---|---|---|---|---|---|
Irx-5183 | . | D0T3DO | |||
Sy-1425 | . | D0HY3D |
Investigative
Patented
Drug Name | Drug Type | External ID | |||
---|---|---|---|---|---|
Pmid27336223-compound-4 | Small molecular drug | D02FAA | |||
Pmid27336223-compound-5 | Small molecular drug | D0AW3F |
Discontinued
Drug Name | Drug Type | External ID | |||
---|---|---|---|---|---|
Etretinate | Small molecular drug | DB00926 | |||
Lg100268 | Small molecular drug | D0YO4D |
References