Details of the Target

General Information of Target

Target ID LDTP02285
Target Name U2 small nuclear ribonucleoprotein B'' (SNRPB2)
Gene Name SNRPB2
Gene ID 6629
Synonyms
U2 small nuclear ribonucleoprotein B''; U2 snRNP B''
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MDIRPNHTIYINNMNDKIKKEELKRSLYALFSQFGHVVDIVALKTMKMRGQAFVIFKELG
SSTNALRQLQGFPFYGKPMRIQYAKTDSDIISKMRGTFADKEKKKEKKKAKTVEQTATTT
NKKPGQGTPNSANTQGNSTPNPQVPDYPPNYILFLNNLPEETNEMMLSMLFNQFPGFKEV
RLVPGRHDIAFVEFENDGQAGAARDALQGFKITPSHAMKITYAKK
Target Bioclass
Other
Family
RRM U1 A/B'' family
Subcellular location
Nucleus
Function Involved in pre-mRNA splicing as component of the spliceosome. Associated with sn-RNP U2, where it contributes to the binding of stem loop IV of U2 snRNA.
Uniprot ID
P08579
Ensemble ID
ENST00000246071.8
HGNC ID
HGNC:11155

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 7 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
TH211
 Probe Info  		Y75(7.10)  LDD0257  [1]
STPyne
 Probe Info  		K103(6.67); K219(10.00); K224(1.02); K85(7.14)  LDD0277  [2]
ATP probe
 Probe Info  		K85(0.00); K101(0.00); K219(0.00); K57(0.00)  LDD0199  [3]
m-APA
 Probe Info  		N.A.  LDD2233  [4]
NHS
 Probe Info  		K85(0.00); K93(0.00)  LDD0010  [5]
1c-yne
 Probe Info  		K111(0.00); K211(0.00); K57(0.00)  LDD0228  [6]
Acrolein
 Probe Info  		N.A.  LDD0217  [7]
PAL-AfBPP Probe
Click To Hide/Show 1 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
C397
 Probe Info  		10.70  LDD2056  [8]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0108  Chloroacetamide HeLa H187(0.00); H36(0.00)  LDD0222  [7]
 LDCM0107  IAA HeLa H187(0.00); H36(0.00)  LDD0221  [7]
 LDCM0109  NEM HeLa H187(0.00); H36(0.00)  LDD0223  [7]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 4 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
5-aminolevulinate synthase, non-specific, mitochondrial (ALAS1) Class-II pyridoxal-phosphate-dependent aminotransferase family P13196
DNA replication licensing factor MCM6 (MCM6) MCM family Q14566
E3 ubiquitin-protein ligase TRIM23 (TRIM23) Arf family P36406
Zinc finger protein RFP (TRIM27) TRIM/RBCC family P14373
Transcription factor
Click To Hide/Show 2 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Zinc finger and BTB domain-containing protein 14 (ZBTB14) Krueppel C2H2-type zinc-finger protein family O43829
Homeobox-containing protein 1 (HMBOX1) . Q6NT76
Cytokine and receptor
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
CKLF-like MARVEL transmembrane domain-containing protein 6 (CMTM6) Chemokine-like factor family Q9NX76
Other
Click To Hide/Show 8 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Golgin subfamily A member 2 (GOLGA2) GOLGA2 family Q08379
Microtubule-associated tumor suppressor candidate 2 (MTUS2) MTUS1 family Q5JR59
Nucleosome assembly protein 1-like 5 (NAP1L5) Nucleosome assembly protein (NAP) family Q96NT1
Paraneoplastic antigen Ma1 (PNMA1) PNMA family Q8ND90
U2 small nuclear ribonucleoprotein A' (SNRPA1) U2 small nuclear ribonucleoprotein A family P09661
GA-binding protein subunit beta-1 (GABPB1) . Q06547
GA-binding protein subunit beta-2 (GABPB2) . Q8TAK5
PRKCA-binding protein (PICK1) . Q9NRD5

References

1 Chemoproteomic profiling of kinases in live cells using electrophilic sulfonyl triazole probes. Chem Sci. 2021 Jan 21;12(9):3295-3307. doi: 10.1039/d0sc06623k.
2 A Paal-Knorr agent for chemoproteomic profiling of targets of isoketals in cells. Chem Sci. 2021 Oct 15;12(43):14557-14563. doi: 10.1039/d1sc02230j. eCollection 2021 Nov 10.
Mass spectrometry data entry: PXD028270
3 Targeted Proteomic Approaches for Proteome-Wide Characterizations of the AMP-Binding Capacities of Kinases. J Proteome Res. 2022 Aug 5;21(8):2063-2070. doi: 10.1021/acs.jproteome.2c00225. Epub 2022 Jul 12.
4 Global profiling of functional histidines in live cells using small-molecule photosensitizer and chemical probe relay labelling. Nat Chem. 2024 Jun 4. doi: 10.1038/s41557-024-01545-6. Online ahead of print.
Mass spectrometry data entry: PXD042377
5 A modification-centric assessment tool for the performance of chemoproteomic probes. Nat Chem Biol. 2022 Aug;18(8):904-912. doi: 10.1038/s41589-022-01074-8. Epub 2022 Jul 21.
Mass spectrometry data entry: PXD027758 , PXD027755 , PXD027760 , PXD027762 , PXD027756 , PXD027591 , PXD007149 , PXD030064 , PXD032392 , PXD027789 , PXD027767 , PXD027764
6 Tunable Amine-Reactive Electrophiles for Selective Profiling of Lysine. Angew Chem Int Ed Engl. 2022 Jan 26;61(5):e202112107. doi: 10.1002/anie.202112107. Epub 2021 Dec 16.
7 ACR-Based Probe for the Quantitative Profiling of Histidine Reactivity in the Human Proteome. J Am Chem Soc. 2023 Mar 8;145(9):5252-5260. doi: 10.1021/jacs.2c12653. Epub 2023 Feb 27.
8 Large-scale chemoproteomics expedites ligand discovery and predicts ligand behavior in cells. Science. 2024 Apr 26;384(6694):eadk5864. doi: 10.1126/science.adk5864. Epub 2024 Apr 26.
Mass spectrometry data entry: PXD041587