Details of the Target
General Information of Target
| Target ID | LDTP02191 | |||||
|---|---|---|---|---|---|---|
| Target Name | Asialoglycoprotein receptor 1 (ASGR1) | |||||
| Gene Name | ASGR1 | |||||
| Gene ID | 432 | |||||
| Synonyms |
CLEC4H1; Asialoglycoprotein receptor 1; ASGP-R 1; ASGPR 1; C-type lectin domain family 4 member H1; Hepatic lectin H1; HL-1 |
|||||
| 3D Structure | ||||||
| Sequence |
MTKEYQDLQHLDNEESDHHQLRKGPPPPQPLLQRLCSGPRLLLLSLGLSLLLLVVVCVIG
SQNSQLQEELRGLRETFSNFTASTEAQVKGLSTQGGNVGRKMKSLESQLEKQQKDLSEDH SSLLLHVKQFVSDLRSLSCQMAALQGNGSERTCCPVNWVEHERSCYWFSRSGKAWADADN YCRLEDAHLVVVTSWEEQKFVQHHIGPVNTWMGLHDQNGPWKWVDGTDYETGFKNWRPEQ PDDWYGHGLGGGEDCAHFTDDGRWNDDVCQRPYRWVCETELDKASQEPPLL |
|||||
| Target Type |
Clinical trial
|
|||||
| Target Bioclass |
Other
|
|||||
| Subcellular location |
Secreted; Membrane
|
|||||
| Function |
Mediates the endocytosis of plasma glycoproteins to which the terminal sialic acid residue on their complex carbohydrate moieties has been removed. The receptor recognizes terminal galactose and N-acetylgalactosamine units. After ligand binding to the receptor, the resulting complex is internalized and transported to a sorting organelle, where receptor and ligand are disassociated. The receptor then returns to the cell membrane surface.
|
|||||
| TTD ID | ||||||
| Uniprot ID | ||||||
| DrugMap ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
| ChEMBL ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
W1 Probe Info |
 |
10.83 | LDD0235 | [1] | |
|
YN-1 Probe Info |
 |
100.00 | LDD0444 | [2] | |
|
YN-4 Probe Info |
 |
100.00 | LDD0445 | [2] | |
|
DBIA Probe Info |
 |
C277(2.14) | LDD3424 | [3] | |
Competitor(s) Related to This Target
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Enzyme
Transporter and channel
Transcription factor
Immunoglobulin
Other
References