General Information of Target

Target ID LDTP02138
Target Name Tyrosine-protein kinase Lck (LCK)
Gene Name LCK
Gene ID 3932
Synonyms
Tyrosine-protein kinase Lck; EC 2.7.10.2; Leukocyte C-terminal Src kinase; LSK; Lymphocyte cell-specific protein-tyrosine kinase; Protein YT16; Proto-oncogene Lck; T cell-specific protein-tyrosine kinase; p56-LCK
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MGCGCSSHPEDDWMENIDVCENCHYPIVPLDGKGTLLIRNGSEVRDPLVTYEGSNPPASP
LQDNLVIALHSYEPSHDGDLGFEKGEQLRILEQSGEWWKAQSLTTGQEGFIPFNFVAKAN
SLEPEPWFFKNLSRKDAERQLLAPGNTHGSFLIRESESTAGSFSLSVRDFDQNQGEVVKH
YKIRNLDNGGFYISPRITFPGLHELVRHYTNASDGLCTRLSRPCQTQKPQKPWWEDEWEV
PRETLKLVERLGAGQFGEVWMGYYNGHTKVAVKSLKQGSMSPDAFLAEANLMKQLQHQRL
VRLYAVVTQEPIYIITEYMENGSLVDFLKTPSGIKLTINKLLDMAAQIAEGMAFIEERNY
IHRDLRAANILVSDTLSCKIADFGLARLIEDNEYTAREGAKFPIKWTAPEAINYGTFTIK
SDVWSFGILLTEIVTHGRIPYPGMTNPEVIQNLERGYRMVRPDNCPEELYQLMRLCWKER
PEDRPTFDYLRSVLEDFFTATEGQYQPQP
Target Type
Successful
Target Bioclass
Enzyme
Family
Protein kinase superfamily, Tyr protein kinase family, SRC subfamily
Subcellular location
Cell membrane
Function
Non-receptor tyrosine-protein kinase that plays an essential role in the selection and maturation of developing T-cells in the thymus and in the function of mature T-cells. Plays a key role in T-cell antigen receptor (TCR)-linked signal transduction pathways. Constitutively associated with the cytoplasmic portions of the CD4 and CD8 surface receptors. Association of the TCR with a peptide antigen-bound MHC complex facilitates the interaction of CD4 and CD8 with MHC class II and class I molecules, respectively, thereby recruiting the associated LCK protein to the vicinity of the TCR/CD3 complex. LCK then phosphorylates tyrosine residues within the immunoreceptor tyrosine-based activation motifs (ITAM) of the cytoplasmic tails of the TCR-gamma chains and CD3 subunits, initiating the TCR/CD3 signaling pathway. Once stimulated, the TCR recruits the tyrosine kinase ZAP70, that becomes phosphorylated and activated by LCK. Following this, a large number of signaling molecules are recruited, ultimately leading to lymphokine production. LCK also contributes to signaling by other receptor molecules. Associates directly with the cytoplasmic tail of CD2, which leads to hyperphosphorylation and activation of LCK. Also plays a role in the IL2 receptor-linked signaling pathway that controls the T-cell proliferative response. Binding of IL2 to its receptor results in increased activity of LCK. Is expressed at all stages of thymocyte development and is required for the regulation of maturation events that are governed by both pre-TCR and mature alpha beta TCR. Phosphorylates other substrates including RUNX3, PTK2B/PYK2, the microtubule-associated protein MAPT, RHOH or TYROBP. Interacts with FYB2.
TTD ID
T12499
Uniprot ID
P06239
DrugMap ID
TT860QF
Ensemble ID
ENST00000333070.4
HGNC ID
HGNC:6524
ChEMBL ID
CHEMBL258

Target Site Mutations in Different Cell Lines

Cell line Mutation details Probe for labeling this protein in this cell
HCT116 SNV: p.R484W .
HCT15 SNV: p.T308A .
JURKAT Deletion: p.A253LfsTer20 Compound 10    Probe Info 
KYSE510 SNV: p.E448Q .
LNCaP clone FGC SNV: p.A143S .
MDAMB453 SNV: p.S377R .
MOLT4 SNV: p.A289D; p.A396V IA-alkyne    Probe Info 
NCIH2291 SNV: p.G456S .

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 9 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
TH211
 Probe Info 
Y192(7.61); Y394(20.00); Y441(20.00); Y470(20.00)  LDD0260  [1]
DBIA
 Probe Info 
C378(5.19); C465(9.86); C465(24.45)  LDD0209  [2]
4-Iodoacetamidophenylacetylene
 Probe Info 
C378(0.00); C217(0.00); C465(0.00); C224(0.00)  LDD0038  [3]
IA-alkyne
 Probe Info 
C378(0.00); C217(0.00); C465(0.00)  LDD0036  [3]
IPIAA_L
 Probe Info 
C224(0.00); C378(0.00); C217(0.00)  LDD0031  [4]
Lodoacetamide azide
 Probe Info 
C378(0.00); C465(0.00); C217(0.00); C224(0.00)  LDD0037  [3]
KY-26
 Probe Info 
N.A.  LDD0301  [5]
Compound 10
 Probe Info 
C217(0.00); C378(0.00); C465(0.00)  LDD2216  [6]
Compound 11
 Probe Info 
C378(0.00); C465(0.00)  LDD2213  [6]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0625  F8 Ramos C217(1.79); C378(1.16); C465(1.01)  LDD2187  [7]
 LDCM0572  Fragment10 Ramos C217(0.93); C378(1.17); C465(1.06)  LDD2189  [7]
 LDCM0573  Fragment11 Ramos C217(1.35); C378(0.28); C465(0.32)  LDD2190  [7]
 LDCM0574  Fragment12 Ramos C217(1.93); C378(1.93); C465(1.99)  LDD2191  [7]
 LDCM0575  Fragment13 Ramos C217(0.95); C378(1.19); C465(0.88)  LDD2192  [7]
 LDCM0576  Fragment14 Ramos C217(1.46); C378(1.40); C465(1.90)  LDD2193  [7]
 LDCM0579  Fragment20 Ramos C217(1.23); C378(1.74); C465(1.83)  LDD2194  [7]
 LDCM0580  Fragment21 Ramos C217(0.88); C378(1.25); C465(0.74)  LDD2195  [7]
 LDCM0582  Fragment23 Ramos C217(0.72); C378(0.92); C465(2.17)  LDD2196  [7]
 LDCM0578  Fragment27 Ramos C217(0.93); C378(0.92); C465(0.75)  LDD2197  [7]
 LDCM0586  Fragment28 Ramos C217(0.74); C378(0.90); C465(0.80)  LDD2198  [7]
 LDCM0588  Fragment30 Ramos C217(1.09); C378(1.40); C465(1.03)  LDD2199  [7]
 LDCM0589  Fragment31 Ramos C217(0.98); C378(1.05); C465(1.19)  LDD2200  [7]
 LDCM0590  Fragment32 Ramos C217(0.97); C378(1.35); C465(1.53)  LDD2201  [7]
 LDCM0468  Fragment33 Ramos C217(0.87); C378(1.08); C465(1.27)  LDD2202  [7]
 LDCM0596  Fragment38 Ramos C217(1.24); C378(0.90); C465(0.90)  LDD2203  [7]
 LDCM0566  Fragment4 Ramos C217(3.41); C378(1.59); C465(1.65)  LDD2184  [7]
 LDCM0610  Fragment52 Ramos C217(1.08); C378(1.23); C465(1.38)  LDD2204  [7]
 LDCM0614  Fragment56 Ramos C217(1.29); C378(1.25); C465(0.73)  LDD2205  [7]
 LDCM0569  Fragment7 Ramos C217(0.98); C378(1.57); C465(1.89)  LDD2186  [7]
 LDCM0571  Fragment9 Ramos C217(1.38); C378(1.87); C465(1.44)  LDD2188  [7]
 LDCM0022  KB02 Ramos C217(1.32); C378(1.66); C465(2.13)  LDD2182  [7]
 LDCM0023  KB03 Jurkat C378(5.19); C465(9.86); C465(24.45)  LDD0209  [2]
 LDCM0024  KB05 MOLM-13 C408(1.85); C217(1.27); C495(1.35)  LDD3333  [8]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 15 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Heat shock protein HSP 90-alpha (HSP90AA1) Heat shock protein 90 family P07900
Threonylcarbamoyladenosine tRNA methylthiotransferase (CDKAL1) Methylthiotransferase family Q5VV42
Protein kinase C theta type (PRKCQ) AGC Ser/Thr protein kinase family Q04759
Hepatocyte growth factor receptor (MET) Tyr protein kinase family P08581
Mast/stem cell growth factor receptor Kit (KIT) Tyr protein kinase family P10721
Receptor-type tyrosine-protein kinase FLT3 (FLT3) Tyr protein kinase family P36888
Tyrosine-protein kinase Lck (LCK) Tyr protein kinase family P06239
Tyrosine-protein kinase SYK (SYK) Tyr protein kinase family P43405
Tyrosine-protein kinase ZAP-70 (ZAP70) Tyr protein kinase family P43403
Tyrosine-protein phosphatase non-receptor type 6 (PTPN6) Protein-tyrosine phosphatase family P29350
Tyrosine-protein phosphatase non-receptor type 22 (PTPN22) Protein-tyrosine phosphatase family Q9Y2R2
Receptor-type tyrosine-protein phosphatase C (PTPRC) Protein-tyrosine phosphatase family P08575
Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1 (CTDSP1) . Q9GZU7
Disintegrin and metalloproteinase domain-containing protein 10 (ADAM10) . O14672
Disintegrin and metalloproteinase domain-containing protein 15 (ADAM15) . Q13444
Transporter and channel
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Heat shock protein HSP 90-beta (HSP90AB1) Heat shock protein 90 family P08238
Transcription factor
Click To Hide/Show 5 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
NF-kappa-B inhibitor delta (NFKBID) NF-kappa-B inhibitor family Q8NI38
Androgen receptor (AR) Nuclear hormone receptor family P10275
Glucocorticoid receptor (NR3C1) Nuclear hormone receptor family P04150
B-cell lymphoma 3 protein (BCL3) . P20749
Trans-acting T-cell-specific transcription factor GATA-3 (GATA3) . P23771
Immunoglobulin
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
T-cell surface glycoprotein CD4 (CD4) . P01730
Other
Click To Hide/Show 10 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Ankyrin repeat and SOCS box protein 9 (ASB9) Ankyrin SOCS box (ASB) family Q96DX5
GRB2-associated-binding protein 1 (GAB1) GAB family Q13480
KH domain-containing, RNA-binding, signal transduction-associated protein 1 (KHDRBS1) KHDRBS family Q07666
Leucine zipper putative tumor suppressor 2 (LZTS2) LZTS2 family Q9BRK4
Mediator of RNA polymerase II transcription subunit 28 (MED28) Mediator complex subunit 28 family Q9H204
Polyubiquitin-C (UBC) Ubiquitin family P0CG48
Complement C1q tumor necrosis factor-related protein 2 (C1QTNF2) . Q9BXJ5
Linker for activation of T-cells family member 1 (LAT) . O43561
SH2 domain-containing protein 2A (SH2D2A) . Q9NP31
Ubiquitin-associated protein 2 (UBAP2) . Q5T6F2

The Drug(s) Related To This Target

Approved
Click To Hide/Show 5 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Dasatinib Small molecular drug D0E6XR
Fostamatinib Small molecular drug DB12010
Nintedanib Small molecular drug DB09079
Ponatinib Small molecular drug DB08901
Zanubrutinib . DB15035
Phase 2
Click To Hide/Show 1 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Vx-680 Small molecular drug D02XNW
Phase 1
Click To Hide/Show 2 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Isis-crp Antisense drug D06CIJ
Jnj-26483327 . D0U3XL
Investigative
Click To Hide/Show 57 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
(4-phenoxy-phenyl)-quinazolin-4-yl-amine Small molecular drug D07AIB
2-(3,4,5-trihydroxy-benzylidene)-malononitrile Small molecular drug D02BUW
3-(4-(O-toluidino)Pyrimidin-2-ylamino)Benzamide Small molecular drug D08DVL
4,5,6,7-tetrabromo-1h-benzo[D][1,2,3]Triazole Small molecular drug D0O1YH
4-(3-chloro-phenoxy)-6,7-dimethoxy-quinazoline Small molecular drug D08WOG
4-phenylsulfanyl-7h-pyrrolo[2,3-d]Pyrimidine Small molecular drug D0M3CT
6-o-tolylquinazolin-2-amine Small molecular drug D09HXU
A-420983 Small molecular drug D0BS6R
A-641359 Small molecular drug D03AER
A-770041 Small molecular drug D06WGX
Amp-pnp Small molecular drug D00ICA
Ap-22408 Small molecular drug DB01830
Bisindolylmaleimide-i Small molecular drug D0TO6S
Bms-536924 Small molecular drug D0M4SY
Cep-5104 Small molecular drug D09QBA
Cgp-57380 Small molecular drug D0A7FQ
Ci-1040 Small molecular drug D0B9BU
Gw-788388 Small molecular drug D0C3AD
Hki-9924129 Small molecular drug D0D5EW
Jnj-10198409 Small molecular drug D0YZ7H
Jnj-28312141 Small molecular drug D0Y4BL
Kn-62 Small molecular drug D0N6ES
L-779450 Small molecular drug D06WJA
Lavendustin A Small molecular drug D0D9TU
Lck Inhibitor Small molecular drug D0OZ2S
Nm-pp1 Small molecular drug D0GT8N
Pd-0166326 Small molecular drug D0P3JW
Pd-0173952 Small molecular drug D0S1KJ
Pd-0173955 Small molecular drug D03NPX
Pd-0173956 Small molecular drug D0GW4Q
Pd-0173958 Small molecular drug D0Z7GH
Pd-0179483 Small molecular drug D0OH3J
Pmid15546730c2 Small molecular drug D08RZB
Pmid17280833c30 Small molecular drug D0D5KZ
Pmid17600705c23 Small molecular drug D04TLI
Pmid21855335c19a Small molecular drug D0IZ8M
Ro-316233 Small molecular drug D0L8HO
Ro31-8220 Small molecular drug D0M5FF
Rpr-108518a Small molecular drug D0L4HJ
Staurosporine Small molecular drug DB02010
Su 6656 Small molecular drug D0CE3R
Tg-100435 Small molecular drug D0H1OK
Wh-4-023 Small molecular drug D0Y1SR
Zm-336372 Small molecular drug D00NWF
1-tert-butyl-3-(4-chloro-phenyl)-1h-pyrazolo[34-d]Pyrimidin-4-ylamine . DB03023
23-diphenyl-n-(2-piperazin-1-ylethyl)Furo[23-b]Pyridin-4-amine . DB07146
3-(2-aminoquinazolin-6-yl)-4-methyl-n-[3-(Trifluoromethyl)Phenyl]Benzamide . DB06925
56-diphenyl-n-(2-piperazin-1-ylethyl)Furo[23-d]Pyrimidin-4-amine . DB07297
N-(2-chloro-6-methylphenyl)-8-[(3s)-3-methylpiperazin-1-yl]Imidazo[15-a]Quinoxalin-4-amine . DB08057
N-(2-chlorophenyl)-5-phenylimidazo[15-a]Pyrazin-8-amine . DB08055
N-(26-dimethylphenyl)-5-phenylimidazo[15-a]Pyrazin-8-amine . DB08056
Phosphoaminophosphonic Acid-adenylate Ester . DB04395
Staurosporinone . D0GB4V
Y-c[D-pen-(3,5-dii)Tyr-gsfc]Kr-nh2 . D07ERV
Y-c[D-pen-(3-i)Tyr-gsfc]Kr-nh2 . D0A2LX
Zotiraciclib . DB16656
{4-[(2s)-2-acetamido-3-({(1s)-1-[3-carbamoyl-4-(Cyclohexylmethoxy)Phenyl]Ethyl}Amino)-3-oxopropyl]-2-phosphonophenoxy}Acetic Acid . DB04003

References

1 Chemoproteomic profiling of kinases in live cells using electrophilic sulfonyl triazole probes. Chem Sci. 2021 Jan 21;12(9):3295-3307. doi: 10.1039/d0sc06623k.
2 Covalent Inhibition by a Natural Product-Inspired Latent Electrophile. J Am Chem Soc. 2023 May 24;145(20):11097-11109. doi: 10.1021/jacs.3c00598. Epub 2023 May 15.
3 Enhancing Cysteine Chemoproteomic Coverage through Systematic Assessment of Click Chemistry Product Fragmentation. Anal Chem. 2022 Mar 8;94(9):3800-3810. doi: 10.1021/acs.analchem.1c04402. Epub 2022 Feb 23.
Mass spectrometry data entry: PXD028853
4 SP3-Enabled Rapid and High Coverage Chemoproteomic Identification of Cell-State-Dependent Redox-Sensitive Cysteines. Mol Cell Proteomics. 2022 Apr;21(4):100218. doi: 10.1016/j.mcpro.2022.100218. Epub 2022 Feb 25.
Mass spectrometry data entry: PXD029500 , PXD031647
5 Direct Target Site Identification of a Sulfonyl-Triazole Covalent Kinase Probe by LC-MS Chemical Proteomics. Anal Chem. 2021 Sep 7;93(35):11946-11955. doi: 10.1021/acs.analchem.1c01591. Epub 2021 Aug 25.
6 Multiplexed CuAAC Suzuki-Miyaura Labeling for Tandem Activity-Based Chemoproteomic Profiling. Anal Chem. 2021 Feb 2;93(4):2610-2618. doi: 10.1021/acs.analchem.0c04726. Epub 2021 Jan 20.
Mass spectrometry data entry: PXD022279
7 Site-specific quantitative cysteine profiling with data-independent acquisition-based mass spectrometry. Methods Enzymol. 2023;679:295-322. doi: 10.1016/bs.mie.2022.07.037. Epub 2022 Sep 7.
Mass spectrometry data entry: PXD027578
8 DrugMap: A quantitative pan-cancer analysis of cysteine ligandability. Cell. 2024 May 9;187(10):2536-2556.e30. doi: 10.1016/j.cell.2024.03.027. Epub 2024 Apr 22.
Mass spectrometry data entry: PXD047840