General Information of Target

Target ID LDTP01981
Target Name Estrogen receptor (ESR1)
Gene Name ESR1
Gene ID 2099
Synonyms
ESR; NR3A1; Estrogen receptor; ER; ER-alpha; Estradiol receptor; Nuclear receptor subfamily 3 group A member 1
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MTMTLHTKASGMALLHQIQGNELEPLNRPQLKIPLERPLGEVYLDSSKPAVYNYPEGAAY
EFNAAAAANAQVYGQTGLPYGPGSEAAAFGSNGLGGFPPLNSVSPSPLMLLHPPPQLSPF
LQPHGQQVPYYLENEPSGYTVREAGPPAFYRPNSDNRRQGGRERLASTNDKGSMAMESAK
ETRYCAVCNDYASGYHYGVWSCEGCKAFFKRSIQGHNDYMCPATNQCTIDKNRRKSCQAC
RLRKCYEVGMMKGGIRKDRRGGRMLKHKRQRDDGEGRGEVGSAGDMRAANLWPSPLMIKR
SKKNSLALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMINW
AKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVEG
MVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTFLSSTLKSLEEKDHIHRVLD
KITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLYDLL
LEMLDAHRLHAPTSRGGASVEETDQSHLATAGSTSSHSLQKYYITGEAEGFPATV
Target Type
Successful
Target Bioclass
Transcription factor
Family
Nuclear hormone receptor family, NR3 subfamily
Subcellular location
Nucleus
Function
Nuclear hormone receptor. The steroid hormones and their receptors are involved in the regulation of eukaryotic gene expression and affect cellular proliferation and differentiation in target tissues. Ligand-dependent nuclear transactivation involves either direct homodimer binding to a palindromic estrogen response element (ERE) sequence or association with other DNA-binding transcription factors, such as AP-1/c-Jun, c-Fos, ATF-2, Sp1 and Sp3, to mediate ERE-independent signaling. Ligand binding induces a conformational change allowing subsequent or combinatorial association with multiprotein coactivator complexes through LXXLL motifs of their respective components. Mutual transrepression occurs between the estrogen receptor (ER) and NF-kappa-B in a cell-type specific manner. Decreases NF-kappa-B DNA-binding activity and inhibits NF-kappa-B-mediated transcription from the IL6 promoter and displace RELA/p65 and associated coregulators from the promoter. Recruited to the NF-kappa-B response element of the CCL2 and IL8 promoters and can displace CREBBP. Present with NF-kappa-B components RELA/p65 and NFKB1/p50 on ERE sequences. Can also act synergistically with NF-kappa-B to activate transcription involving respective recruitment adjacent response elements; the function involves CREBBP. Can activate the transcriptional activity of TFF1. Also mediates membrane-initiated estrogen signaling involving various kinase cascades. Essential for MTA1-mediated transcriptional regulation of BRCA1 and BCAS3. Maintains neuronal survival in response to ischemic reperfusion injury when in the presence of circulating estradiol (17-beta-estradiol/E2).; [Isoform 3]: Involved in activation of NOS3 and endothelial nitric oxide production. Isoforms lacking one or several functional domains are thought to modulate transcriptional activity by competitive ligand or DNA binding and/or heterodimerization with the full-length receptor. Binds to ERE and inhibits isoform 1.
TTD ID
T89534
Uniprot ID
P03372
DrugMap ID
TTAHMI6
Ensemble ID
ENST00000206249.8
HGNC ID
HGNC:3467
ChEMBL ID
CHEMBL206

Target Site Mutations in Different Cell Lines

Cell line Mutation details Probe for labeling this protein in this cell
CAL27 SNV: p.R158H .
CCK81 SNV: p.G160S .
HT115 SNV: p.E247K .
MEWO SNV: p.M297I .
NCIH1993 SNV: p.N92H .
NCIH716 SNV: p.T431K .
SW1271 Insertion: p.S450IfsTer6 .

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 4 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
IA-alkyne
 Probe Info 
C227(5.26)  LDD2157  [1]
DBIA
 Probe Info 
C72(1.69)  LDD2268  [2]
Curcusone 37
 Probe Info 
2.09  LDD0188  [3]
NAIA_5
 Probe Info 
N.A.  LDD2223  [4]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0033  Curcusone1d MCF-7 2.09  LDD0188  [3]
 LDCM0022  KB02 BRX211 C72(1.69)  LDD2268  [2]
 LDCM0023  KB03 BRX211 C72(2.48)  LDD2685  [2]
 LDCM0024  KB05 BRX211 C72(2.59)  LDD3102  [2]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 24 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
ATPase family AAA domain-containing protein 2 (ATAD2) AAA ATPase family Q6PL18
Protein arginine N-methyltransferase 2 (PRMT2) Protein arginine N-methyltransferase family P55345
Histone-lysine N-methyltransferase NSD3 (NSD3) Histone-lysine methyltransferase family Q9BZ95
Histone-lysine N-methyltransferase 2D (KMT2D) Histone-lysine methyltransferase family O14686
Bifunctional arginine demethylase and lysyl-hydroxylase JMJD6 (JMJD6) JMJD6 family Q6NYC1
E3 ubiquitin-protein ligase Mdm2 (MDM2) MDM2/MDM4 family Q00987
Histone acetyltransferase KAT5 (KAT5) MYST (SAS/MOZ) family Q92993
Protein NDRG2 (NDRG2) NDRG family Q9UN36
Ubiquitin carboxyl-terminal hydrolase 7 (USP7) Peptidase C19 family Q93009
Sentrin-specific protease 5 (SENP5) Peptidase C48 family Q96HI0
Serine/threonine-protein phosphatase PP1-gamma catalytic subunit (PPP1CC) PPP phosphatase family P36873
Serine/threonine-protein phosphatase 5 (PPP5C) PPP phosphatase family P53041
Serine/threonine-protein kinase LATS1 (LATS1) AGC Ser/Thr protein kinase family O95835
Serine/threonine-protein kinase LMTK3 (LMTK3) Tyr protein kinase family Q96Q04
Epidermal growth factor receptor (EGFR) Tyr protein kinase family P00533
Proto-oncogene tyrosine-protein kinase Src (SRC) Tyr protein kinase family P12931
Ras-related C3 botulinum toxin substrate 3 (RAC3) Rho family P60763
Nuclear receptor coactivator 1 (NCOA1) SRC/p160 nuclear receptor coactivator family Q15788
Nuclear receptor coactivator 3 (NCOA3) SRC/p160 nuclear receptor coactivator family Q9Y6Q9
Dynamin-1-like protein (DNM1L) Dynamin/Fzo/YdjA family O00429
Lysine-specific demethylase 6B (KDM6B) UTX family O15054
ADP-ribose glycohydrolase MACROD1 (MACROD1) . Q9BQ69
Breast cancer type 1 susceptibility protein (BRCA1) . P38398
Transcription intermediary factor 1-alpha (TRIM24) . O15164
Transporter and channel
Click To Hide/Show 3 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Progesterone receptor (PGR) Nuclear hormone receptor family P06401
Glutamate receptor-interacting protein 1 (GRIP1) . Q9Y3R0
Wolframin (WFS1) . O76024
Transcription factor
Click To Hide/Show 13 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Cyclic AMP-dependent transcription factor ATF-1 (ATF1) BZIP family P18846
CCAAT/enhancer-binding protein beta (CEBPB) BZIP family P17676
Estrogen receptor (ESR1) Nuclear hormone receptor family P03372
Estrogen receptor beta (ESR2) Nuclear hormone receptor family Q92731
Transcription factor Sp1 (SP1) Sp1 C2H2-type zinc-finger protein family P08047
Transcription factor Sp3 (SP3) Sp1 C2H2-type zinc-finger protein family Q02447
Nuclear receptor coactivator 2 (NCOA2) SRC/p160 nuclear receptor coactivator family Q15596
Achaete-scute homolog 4 (ASCL4) . Q6XD76
AT-rich interactive domain-containing protein 5A (ARID5A) . Q03989
Forkhead box protein O1 (FOXO1) . Q12778
Forkhead box protein O3 (FOXO3) . O43524
Transcription factor p65 (RELA) . Q04206
Zinc finger protein 366 (ZNF366) . Q8N895
Other
Click To Hide/Show 19 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Histone chaperone ASF1A (ASF1A) ASF1 family Q9Y294
Polycomb group protein ASXL1 (ASXL1) Asx family Q8IXJ9
Bladder cancer-associated protein (BLCAP) BLCAP family P62952
CCN family member 2 (CCN2) CCN family P29279
Cbp/p300-interacting transactivator 1 (CITED1) CITED family Q99966
CUE domain-containing protein 2 (CUEDC2) CUEDC2 family Q9H467
CDK2-associated and cullin domain-containing protein 1 (CACUL1) Cullin family Q86Y37
HCLS1-associated protein X-1 (HAX1) HAX1 family O00165
Mediator of RNA polymerase II transcription subunit 1 (MED1) Mediator complex subunit 1 family Q15648
Prohibitin-2 (PHB2) Prohibitin family Q99623
Protein UXT (UXT) UXT family Q9UBK9
DDB1- and CUL4-associated factor 13 (DCAF13) WD repeat DCAF13/WDSOF1 family Q9NV06
A-kinase anchor protein 13 (AKAP13) . Q12802
Endothelial differentiation-related factor 1 (EDF1) . O60869
Myosin light polypeptide 6 (MYL6) . P60660
PAXIP1-associated glutamate-rich protein 1 (PAGR1) . Q9BTK6
RNA binding protein fox-1 homolog 2 (RBFOX2) . O43251
Scaffold attachment factor B2 (SAFB2) . Q14151
SHC-transforming protein 1 (SHC1) . P29353

The Drug(s) Related To This Target

Approved
Click To Hide/Show 81 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Arzoxifene Small molecular drug D06LOQ
Arzoxifene Small molecular drug DB06249
Bazedoxifene Small molecular drug D0JY8T
Cenestin Small molecular drug D0N6YV
Clomifene Small molecular drug D0CT9Y
Clomiphene Citrate Small molecular drug D0I5WB
Conjugated Estrogens Small molecular drug DB00286
Cyclofenil Small molecular drug D0X1EZ
Danazol Small molecular drug D09IPV
Desogestrel Small molecular drug DB00304
Dienestrol Small molecular drug D09ZQN
Diethylstilbestrol Small molecular drug D0Y2NE
Dobutamine Small molecular drug DB00841
Estradiol Small molecular drug D08QMX
Estradiol Acetate Small molecular drug D0T7ZQ
Estradiol Acetate Small molecular drug DB13952
Estradiol Cypionate Small molecular drug D0U0XD
Estradiol Cypionate Small molecular drug DB13954
Estradiol Valerate Small molecular drug D07VBA
Estradiol Valerate Small molecular drug DB13956
Estramustine Small molecular drug DB01196
Estriol Small molecular drug D0Z1FX
Estrone Small molecular drug D00ZFP
Estrone Sulfate Small molecular drug DB04574
Estropipate Small molecular drug D03IUY
Ethinyl Estradiol Small molecular drug D06NXY
Ethinylestradiol Small molecular drug DB00977
Ethynodiol Diacetate Small molecular drug DB00823
Eugenol Small molecular drug DB09086
Fluoxymesterone Small molecular drug DB01185
Fosfestrol Small molecular drug D0JO8Z
Fulvestrant Small molecular drug D0JO7Y
Gestrinone Small molecular drug D0M5RF
Hexachlorophene Small molecular drug DB00756
Lasofoxifene Small molecular drug D09NMD
Levonorgestrel Small molecular drug DB00367
Levormeloxifene Small molecular drug D0W9GA
Lindane Small molecular drug DB00431
Medroxyprogesterone Acetate Small molecular drug DB00603
Melatonin Small molecular drug DB01065
Mestranol Small molecular drug D0J1ML
Methyltestosterone Small molecular drug DB06710
Mitotane Small molecular drug D0Z5OE
Naloxone Small molecular drug DB01183
Nomegestrol Acetate Small molecular drug D0V2JK
Norgestimate Small molecular drug DB00957
Ospemifene Small molecular drug D02CTS
Oxybenzone Small molecular drug DB01428
Permethrin Small molecular drug DB04930
Phenolphthalein Small molecular drug DB04824
Polyestradiol Phosphate Small molecular drug DB09369
Prasterone Small molecular drug DB01708
Progesterone Small molecular drug DB00396
Promestriene Small molecular drug D0C4NY
Quinestrol Small molecular drug D04UZT
Raloxifene Small molecular drug D01XBA
Tamoxifen Small molecular drug D07KSG
Testosterone Small molecular drug DB00624
Tibolone Small molecular drug DB09070
Toremifene Small molecular drug D04VFJ
Trilostane Small molecular drug DB01108
Conjugated Estrogens A . D0A2RG
Conjugated Estrogens B . D01ICU
Enzacamene . DB11219
Esterified Estrogens . D0R6RE
Estradiol Benzoate . DB13953
Estradiol Dienanthate . DB13955
Estrogen . D0M8PD
Fluoroestradiol F-18 . DB15690
Homosalate . DB11064
Norethynodrel . DB09371
Octocrylene . DB09535
Premarin/Trimegestone . D0S1UW
Synthetic Conjugated Estrogens A . DB09317
Synthetic Conjugated Estrogens B . DB09318
Testosterone Cypionate . DB13943
Testosterone Enanthate . DB13944
Zinc . DB01593
Zinc Acetate . DB14487
Zinc Chloride . DB14533
Zinc Sulfate Unspecified Form . DB14548
Phase 3
Click To Hide/Show 7 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Acolbifene Small molecular drug D0XB0T
Npc-01 . D0VF3C
Premarin/Pravachol . D0G7IV
Rad-1901 . D07KUN
Synthetic Conjugated Estrogen . D02BAE
Trimegestone/Ethinyl Estradiol . D0C6XR
Tztx-001 . D0IC7A
Phase 2
Click To Hide/Show 11 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Op-1250 Small interfering RNA DZ91HE
Afimoxifene Small molecular drug D09NST
Azd9833 Small molecular drug DATO92
Endoxifen Small molecular drug D0W4EB
Estetrol Small molecular drug D0L3TR
Icaritin Small molecular drug D0L0BX
Sr 16234 Small molecular drug D02PYN
Zn-c5 Small molecular drug DJ1W5R
Arn-810 . D00JFE
Gtx-758 . D0E7FM
H3b-6545 . D0Z5VW
Phase 1
Click To Hide/Show 9 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Chf-4227 Small molecular drug D08OUV
D-0502 Small molecular drug D09OJI
Ttc-352 Small molecular drug DT4WU3
Atd Transdermal Gel . D09BQO
Azd9496 . D0X1OW
Cc-8490 . D03YGP
G1t-48 . DG38QS
Ly3484356 . DH4Y3O
Sco-120 . DNTW18
Preclinical
Click To Hide/Show 6 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Bn-aa-003-ny . D0P5NU
Bn-ao-014 . D01EXY
Bn-cb-045 . D0QI9N
Bn-df-037 . D0N6YN
Bn-gu-005-dhp . D0QX9U
Bn-od-026 . D06YGP
Investigative
Click To Hide/Show 242 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Sng-8023 Antibody D03NWC
1,2-bis-(4-hydroxy-phenyl)-3h-inden-5-ol Small molecular drug D0Z0UC
1,8-dichloro-6-(4-hydroxy-phenyl)-naphthalen-2-ol Small molecular drug D05FUY
1-bromo-6-(4-hydroxy-phenyl)-naphthalen-2-ol Small molecular drug D0S6NV
1-chloro-6-(4-hydroxyphenyl)-2-naphthol Small molecular drug D01KJU
1-fluoro-6-(4-hydroxy-phenyl)-naphthalen-2-ol Small molecular drug D0ZT4U
17-methyl-17-alpha-dihydroequilenin Small molecular drug D08JCJ
2,3-diphenyl-1h-indole Small molecular drug D0P7PK
2,4-dibenzylamino-6-isopentylpyrimidine Small molecular drug D03BOO
2,4-diisobutylamino-6-isopentylpyrimidine Small molecular drug D02GLM
2-(2-chloro-4-hydroxy-phenyl)-benzooxazol-5-ol Small molecular drug D0V7QZ
2-(3-butoxy-4-hydroxy-phenyl)-benzooxazol-6-ol Small molecular drug D0DK9S
2-(3-chloro-4-hydroxy-phenyl)-benzooxazol-5-ol Small molecular drug D0K1TW
2-(3-chloro-4-hydroxy-phenyl)-benzooxazol-6-ol Small molecular drug D08HCF
2-(3-fluoro-4-hydroxy-phenyl)-benzooxazol-5-ol Small molecular drug D09TQE
2-(3-fluoro-4-hydroxy-phenyl)-benzooxazol-6-ol Small molecular drug D0AD3U
2-(3-hydroxyphenyl)-1,2'-spirobi[1h-indene]-5-ol Small molecular drug D01SWO
2-(3-hydroxyphenyl)-1,2'-spirobi[1h-indene]-6-ol Small molecular drug D03DVM
2-(4-hydroxy-naphthalen-1-yl)-benzooxazol-6-ol Small molecular drug D0W3FF
2-(4-hydroxy-phenyl)-4-methoxy-quinolin-6-ol Small molecular drug D0L6IQ
2-(4-hydroxy-phenyl)-7-isopropyl-benzooxazol-5-ol Small molecular drug D02LCC
2-(4-hydroxy-phenyl)-7-methoxy-benzofuran-5-ol Small molecular drug D03XEU
2-(4-hydroxy-phenyl)-7-methoxy-benzooxazol-5-ol Small molecular drug D05JPW
2-(4-hydroxy-phenyl)-7-methyl-benzofuran-5-ol Small molecular drug D0C6AP
2-(4-hydroxy-phenyl)-7-phenyl-benzooxazol-5-ol Small molecular drug D07VPM
2-(4-hydroxy-phenyl)-7-propenyl-benzooxazol-5-ol Small molecular drug D02EJM
2-(4-hydroxy-phenyl)-7-propyl-benzooxazol-5-ol Small molecular drug D04WHH
2-(4-hydroxy-phenyl)-7-vinyl-benzooxazol-5-ol Small molecular drug D0YW4C
2-(4-hydroxy-phenyl)-benzooxazol-5-ol Small molecular drug D0N0OY
2-(4-hydroxy-phenyl)-benzooxazol-6-ol Small molecular drug D09CQC
2-(4-hydroxy-phenyl)-quinolin-6-ol Small molecular drug D00CWN
2-(4-hydroxy-phenyl)Benzofuran-5-ol Small molecular drug D01WCA
2-(4-hydroxyphenyl)-1,2'-spirobi[1h-indene]-5-ol Small molecular drug D0X2VK
2-(5-hydroxy-naphthalen-1-yl)-benzooxazol-6-ol Small molecular drug D0U2VA
2-(6-hydroxy-naphthalen-1-yl)-benzooxazol-5-ol Small molecular drug D01QXL
2-(6-hydroxy-naphthalen-1-yl)-benzooxazol-6-ol Small molecular drug D0YH4T
2-(6-hydroxy-naphthalen-2-yl)-benzooxazol-5-ol Small molecular drug D02JJU
2-(6-hydroxy-naphthalen-2-yl)-benzooxazol-6-ol Small molecular drug D00HZT
2-amino-1-methyl-6-phenylimidazo(45-b)Pyridine Small molecular drug DB08398
2-amino-1-methyl-6-phenylimidazo[4,5-b]Pyridine Small molecular drug D00ZAJ
2-naphthalen-1-yl-benzooxazol-6-ol Small molecular drug D0H1CO
2-phenyl-1,2'-spirobi[1h-indene]-5'-ol Small molecular drug D0O2KP
3'-methoxy-4'hydroxyclomiphene Small molecular drug D0A1JP
3,8-dihydroxy-4-methyl-6h-benzo[C]Chromen-6-one Small molecular drug D0C5FY
3,8-dihydroxy-7-methyl-6h-benzo[C]Chromen-6-one Small molecular drug D0HM8Y
3-(2-hydroxy-phenyl)-benzo[D]Isoxazol-6-ol Small molecular drug D04EAY
3-(4-hydroxy-phenyl)-benzo[D]Isoxazol-5-ol Small molecular drug D08FLV
3-(4-hydroxy-phenyl)-benzo[D]Isoxazol-6-ol Small molecular drug D0B1HP
3-(4-hydroxyphenyl)-7-isobutoxychromen-4-one Small molecular drug D0GH1I
3-(4-hydroxyphenyl)-7-isopropoxychromen-4-one Small molecular drug D0O9UY
3-(5-hydroxy-benzooxazol-2-yl)-benzene-1,2-diol Small molecular drug D0W2YR
3-(6-hydroxy-benzooxazol-2-yl)-benzene-1,2-diol Small molecular drug D0S2ZJ
3-chloro-2-(4-hydroxyphenyl)-2h-indazol-5-ol Small molecular drug D01ZRX
3-chloro-4-(4-hydroxyphenyl)Salicylaldoxime Small molecular drug D01UAO
3-ethyl-2-(4-hydroxyphenyl)-2h-indazol-5-ol Small molecular drug D0A8CS
3-hydroxy-8,10-dimethyl-6h-benzo[C]Chromen-6-one Small molecular drug D0U0ZE
3-[1-ethyl-2-(3-hydroxyphenyl)Butyl]Phenol Small molecular drug D00AAU
4',5,7-trihydroxy-6,8-dimethylisoflavone Small molecular drug D0NN0V
4,10-dimethyl-6h-benzo[C]Chromene-3,8-diol Small molecular drug D00URP
4,6,10-trimethyl-6h-benzo[C]Chromene-3,8-diol Small molecular drug D0S8EB
4,6,6,7-tetramethyl-6h-benzo[C]Chromene-3,8-diol Small molecular drug D0H5HI
4,6,7,10-tetramethyl-6h-benzo[C]Chromene-3,8-diol Small molecular drug D0O6FX
4,6,7-trimethyl-6h-benzo[C]Chromene-3,8-diol Small molecular drug D0O5KR
4,7-dimethyl-6h-benzo[C]Chromene-3,8-diol Small molecular drug D09PXU
4-(1,2-diphenyl-but-1-enyl)-phenol Small molecular drug D0V7OK
4-(1-benzyl-7-chloro-1h-indazol-3-yl)Phenol Small molecular drug D09WEK
4-(1-butyl-7-chloro-1h-indazol-3-yl)Phenol Small molecular drug D0Q4VG
4-(1-cyclopentyl-7-fluoro-1h-indazol-3-yl)Phenol Small molecular drug D0F8LS
4-(2-phenyl-1h-benzo[D]Imidazol-1-yl)Phenol Small molecular drug D0I5HZ
4-(2-phenyl-1h-indol-3-yl)Phenol Small molecular drug D0K0IC
4-(3-(4-hydroxyphenyl)-1h-indol-2-yl)Phenol Small molecular drug D0U7KV
4-(3-phenyl-1h-indol-2-yl)Phenol Small molecular drug D00NEK
4-(5-hydroxy-benzooxazol-2-yl)-benzene-1,3-diol Small molecular drug D0R7AG
4-(6-hydroxy-1h-indazol-3-yl)Benzene-1,3-diol Small molecular drug D0K5LX
4-(6-hydroxy-1h-indazol-3-yl)Benzene-13-diol Small molecular drug DB08048
4-(6-hydroxy-benzooxazol-2-yl)-benzene-1,2-diol Small molecular drug D0C9XK
4-(6-hydroxy-benzooxazol-2-yl)-benzene-1,3-diol Small molecular drug D03RYU
4-(7-chloro-1-cyclohexyl-1h-indazol-3-yl)Phenol Small molecular drug D0H8ZT
4-(7-chloro-1-cyclopentyl-1h-indazol-3-yl)Phenol Small molecular drug D0V7ZI
4-(7-chloro-1-propyl-1h-indazol-3-yl)Phenol Small molecular drug D0C4VX
4-(7-methyl-1-propyl-1h-indazol-3-yl)Phenol Small molecular drug D0J6KN
4-benzo[D]Isoxazol-3-yl-benzene-1,3-diol Small molecular drug D08WDN
4-benzyl-2,6-diisobutylamino-pyrimidine Small molecular drug D04TPC
4-hydroxy-n,N-diphenylbenzenesulfonamide Small molecular drug D0Z9ZY
4-hydroxy-n-isopropyl-n-phenylbenzenesulfonamide Small molecular drug D0J3PM
4-hydroxy-n-neopentyl-n-phenylbenzenesulfonamide Small molecular drug D08LVT
4-hydroxy-n-phenyl-n-propylbenzenesulfonamide Small molecular drug D0L0RK
4-naphthalen-2-yl-phenol Small molecular drug D0L3AX
4-[1,2-bis(4-hydroxyphenyl)But-1-enyl]Phenol Small molecular drug D0I1NX
4-[1,2-bis(4-hydroxyphenyl)Hex-1-enyl]Phenol Small molecular drug D06DNN
4-[1,2-bis(4-hydroxyphenyl)Pent-1-enyl]Phenol Small molecular drug D02DVT
4-[1,2-bis(4-hydroxyphenyl)Vinyl]Phenol Small molecular drug D00OLH
4-[1-(4-hydroxyphenyl)-2-phenylbut-1-enyl]Phenol"] Small molecular drug D0K8QD
4-[1-(4-hydroxyphenyl)-2-phenylhex-1-enyl]Phenol Small molecular drug D0XC3V
4-[1-(4-hydroxyphenyl)-2-phenylpent-1-enyl]Phenol Small molecular drug D0OV3S
4-[1-(4-hydroxyphenyl)-2-phenylprop-1-enyl]Phenol Small molecular drug D0Q6MS
4-[1-(4-hydroxyphenyl)-2-phenylvinyl]Phenol Small molecular drug D07TGS
4-[2,2-bis(4-hydroxyphenyl)-1-methylvinyl]Phenol Small molecular drug D03EOD
5-bromo-2-(4-hydroxy-phenyl)-quinolin-6-ol Small molecular drug D0J0AG
5-chloro-2-(4-hydroxy-phenyl)-benzooxazol-6-ol Small molecular drug D01KSR
5-chloro-2-(4-hydroxy-phenyl)-quinolin-6-ol Small molecular drug D02HGS
5-hydroxy-2-phenylisoindoline-1,3-dione Small molecular drug D0X6LK
6-(2,5-difluoro-4-hydroxy-phenyl)-naphthalen-2-ol Small molecular drug D0X7DJ
6-(2,6-difluoro-4-hydroxy-phenyl)-naphthalen-2-ol Small molecular drug D0V6KJ
6-(2-chloro-4-hydroxy-phenyl)-naphthalen-2-ol Small molecular drug D02OKF
6-(2-fluoro-4-hydroxy-phenyl)-naphthalen-2-ol Small molecular drug D0CC6R
6-(3,5-difluoro-4-hydroxy-phenyl)-naphthalen-2-ol Small molecular drug D0MY8V
6-(3-chloro-4-hydroxy-phenyl)-naphthalen-2-ol Small molecular drug D0K6TE
6-(3-fluoro-4-hydroxy-phenyl)-naphthalen-2-ol Small molecular drug D0X4VN
6-(3-hydroxy-phenyl)-naphthalen-1-ol Small molecular drug D0HR8L
6-(4-hydroxy-2-methoxy-phenyl)-naphthalen-2-ol Small molecular drug D0P6FN
6-(4-hydroxy-2-methyl-phenyl)-naphthalen-2-ol Small molecular drug D01GPY
6-(4-hydroxy-phenyl)-1-methoxy-naphthalen-2-ol Small molecular drug D0M0XL
6-(4-hydroxy-phenyl)-1-methyl-naphthalen-2-ol Small molecular drug D07XBD
6-(4-hydroxy-phenyl)-1-nitro-naphthalen-2-ol Small molecular drug D0H2FI
6-(4-hydroxy-phenyl)-1-phenyl-naphthalen-2-ol Small molecular drug D0VN2R
6-(4-hydroxy-phenyl)-naphthalen-2-ol Small molecular drug D07LUI
6-butyl-2,4-dipropylaminopyrimidine Small molecular drug D0C9XW
6-chloro-2-(4-hydroxy-phenyl)-benzooxazol-5-ol Small molecular drug D05JKC
6-ethyl-2,4-diisobutylaminopyrimidine Small molecular drug D0H6MZ
6-ethyl-4,7-dimethyl-6h-benzo[C]Chromene-3,8-diol Small molecular drug D00IXB
6-phenyl-naphthalen-2-ol Small molecular drug D0UV9G
7-(4-hydroxy-phenyl)-naphthalen-2-ol Small molecular drug D09DEK
7-allyl-2-(4-hydroxy-phenyl)-benzooxazol-5-ol Small molecular drug D00ZBL
7-bromo-2-(4-hydroxy-phenyl)-benzofuran-5-ol Small molecular drug D0L2MU
7-butyl-2-(4-hydroxy-phenyl)-benzooxazol-5-ol Small molecular drug D03GYS
7-chloro-2-(4-hydroxy-phenyl)-benzofuran-5-ol Small molecular drug D05YIU
7-cyclopentyloxy-3-(4-hydroxyphenyl)Chromen-4-one Small molecular drug D05QTG
7-ethyl-2-(4-hydroxy-phenyl)-benzooxazol-5-ol Small molecular drug D06OAL
7-ethynyl-2-(4-hydroxy-phenyl)-benzooxazol-5-ol Small molecular drug D0S0SZ
7-phenyl-naphthalen-2-ol Small molecular drug D0SR8Q
8-(2,2-dimethylpropyl)Naringenin Small molecular drug D03QHG
8-(2-methylpropyl)Naringenin Small molecular drug D0Y2LJ
8-(3-methylbutyl)Naringenin Small molecular drug D09NOH
8-benzylnaringenin Small molecular drug D0D1LB
8-chloro-6-(4-hydroxy-phenyl)-naphthalen-2-ol Small molecular drug D08VDX
8-fluoro-6-(4-hydroxy-phenyl)-naphthalen-2-ol Small molecular drug D0FD6Z
8-methylnaringenin Small molecular drug D07XUY
8-n-heptylnaringenin Small molecular drug D0J2NG
8-n-nonylnaringenin Small molecular drug D0W5HT
8-n-pentylnaringenin Small molecular drug D0LI0M
8-n-propylnaringenin Small molecular drug D0W0LG
8-n-undecylnaringenin Small molecular drug D05KXP
Allylestrenol Small molecular drug DB01431
Broussonin A Small molecular drug D06DDT
Coumestrol Small molecular drug D02DML
Cp-394531 Small molecular drug D0L5IC
Cp-409069 Small molecular drug D0J7XZ
Custirsen Small molecular drug DB05487
Daidzein Small molecular drug D0SY2M
Dihydroraloxifene Small molecular drug D02VIW
Effusol Small molecular drug D0W4WF
Equilin Small molecular drug DB02187
Erteberel Small molecular drug DB07933
Genistein Small molecular drug DB01645
Gsk-5182 Small molecular drug D09NFD
Gw7604 Small molecular drug D04SAO
Jnj-17148066 Small molecular drug D00DJX
Jnj-19398990 Small molecular drug D09UQU
Jnj-26529126 Small molecular drug D0X0RJ
Jnj-26529152 Small molecular drug D02TPO
Methyl-piperidino-pyrazole Small molecular drug D0XF9F
Mprp Small molecular drug D07TGW
N,N,N-triisobutyl-pyrimidine-2,4,6-triamine Small molecular drug D07HBQ
N-allyl-4-hydroxy-n-phenylbenzenesulfonamide Small molecular drug D0AD8G
N-benzyl-4-hydroxy-n-phenylbenzenesulfonamide Small molecular drug D00XLU
N-butyl-4-hydroxy-n-phenylbenzenesulfonamide Small molecular drug D0M4LQ
N-cyclohexyl-4-hydroxy-n-phenylbenzenesulfonamide Small molecular drug D01XCA
N-ethyl-4-hydroxy-n-phenylbenzenesulfonamide Small molecular drug D09ULU
Nafoxidine Small molecular drug D00FUO
Naringenin Small molecular drug DB03467
Phthalic Acid Small molecular drug DB02746
Propylpyrazoletriol Small molecular drug D0Y8UF
Quercetin Small molecular drug DB04216
R,R-thc Small molecular drug D04SEX
Resveratrol Small molecular drug DB02709
Sophoraflavanone B Small molecular drug D0S8AV
Stx Small molecular drug D0E6AP
Tamoxifen Butyl Bromide Small molecular drug D0S5RI
Tamoxifen Ethyl Bromide Small molecular drug D0C6UR
Tamoxifen Isopropyl Bromide Small molecular drug D08GWS
Way-169916 Small molecular drug D0Y9BO
Way200070 Small molecular drug D06SCS
Zk-164015 Small molecular drug D0P0FN
[1,1':2',1'terphenyl-4'-carbaldehyde Oxime Small molecular drug D00HUB
(2r3r4s)-3-(4-hydroxyphenyl)-4-methyl-2-[4-(2-pyrrolidin-1-ylethoxy)Phenyl]Chroman-6-ol . DB07567
(3as4r9br)-22-difluoro-4-(4-hydroxyphenyl)-1233a49b-hexahydrocyclopenta[C]Chromen-8-ol . DB07638
(3as4r9br)-4-(4-hydroxyphenyl)-1233a49b-hexahydrocyclopenta[C]Chromen-9-ol . DB08737
(3as4r9br)-4-(4-hydroxyphenyl)-6-(Methoxymethyl)-1233a49b-hexahydrocyclopenta[C]Chromen-8-ol . DB08020
(9alpha13beta17beta)-2-[(1z)-but-1-en-1-yl]Estra-135(10)-triene-317-diol . DB07678
(9beta11alpha13alpha14beta17alpha)-11-(Methoxymethyl)Estra-1(10)24-triene-317-diol . DB07707
1-[4-(Octahydro-pyrido[12-a]Pyrazin-2-yl)-phenyl]-2-phenyl-1234-tetrahydro-isoquinolin-6-ol . DB03802
2-(4-hydroxy-phenyl)-4-vinyl-quinolin-6-ol . D0K7HR
2-(4-hydroxyphenyl)Benzo[B]Thiophen-6-ol . DB08773
2-methoxy-6-{(E)-[(4-methylphenyl)Imino]Methyl}Phenol . DB13869
2-phenyl-1-[4-(2-piperidin-1-yl-ethoxy)-phenyl]-1234-tetrahydro-isoquinolin-6-ol . DB04471
4-(2-amino-1-methyl-1h-imidazo[45-b]Pyridin-6-yl)Phenol . DB06898
4-bromo-2-(4-hydroxy-phenyl)-quinolin-6-ol . D03CBX
4-chloro-2-(4-hydroxy-phenyl)-quinolin-6-ol . D01TUB
4-ethyl-2-(4-hydroxy-phenyl)-quinolin-6-ol . D09FWS
4-ethynyl-2-(4-hydroxy-phenyl)-quinolin-6-ol . D08SJL
4-[(1s2r5s)-448-trimethyl-3-oxabicyclo[3.3.1]Non-7-en-2-yl]Phenol . DB08595
4-[(1s2s5s)-5-(Hydroxymethyl)-689-trimethyl-3-oxabicyclo[3.3.1]Non-7-en-2-yl]Phenol . DB07195
4-[(1s2s5s)-5-(Hydroxymethyl)-8-methyl-3-oxabicyclo[3.3.1]Non-7-en-2-yl]Phenol . DB07086
4-[(1s2s5s9r)-5-(Hydroxymethyl)-89-dimethyl-3-oxabicyclo[3.3.1]Non-7-en-2-yl]Phenol . DB07087
4-[1-allyl-7-(Trifluoromethyl)-1h-indazol-3-yl]Benzene-13-diol . DB08047
6-(3-hydroxy-phenyl)-naphthalen-2-ol . D0P8PK
6-(4-hydroxy-phenyl)-naphthalen-1-ol . D0H8PI
7-(3-hydroxy-phenyl)-naphthalen-2-ol . D01IAT
Ap1081 . DB05233
Benzophenone . DB01878
Beta-naphthoflavone . DB06732
Carboron Cluster With Phenol . D07KXE
Chf 4227 . DB05882
Compound 18 . DB02715
Compound 19 . DB02615
Compound 4-d . DB03742
Diethyl (1r2s3r4s)-56-bis(4-hydroxyphenyl)-7-oxabicyclo[2.2.1]Hept-5-ene-23-dicarboxylate . DB08320
Dimethyl (1r4s)-56-bis(4-hydroxyphenyl)-7-oxabicyclo[2.2.1]Hepta-25-diene-23-dicarboxylate . DB07932
Doxorubicin-formaldehyde Conjugate . D0RI6O
Elacestrant . DB06374
Estriol E3 . D0V4DH
Estriol Tripropionate . DB14641
Geldanamycin-estradiol Hybrid . D0H6OS
Lterhkilhrllqegspsd . D04PEM
N-[(1r)-3-(4-hydroxyphenyl)-1-methylpropyl]-2-(2-phenyl-1h-indol-3-yl)Acetamide . DB07991
Org-37663 . D0I6QZ
Ormeloxifene . DB13310
Propyl Gallate . DB12450
Pyrazole . DB02757
Ractopamine . DB11541
Rg6046 . D0E3UW
Serms . D0GY3R
Sng-163 . D09BDK
Sng-8006 . D01NDN
Sng-8033 . D03AVA
Stanolone Acetate . DB13951
Tas-108 . DB05966
Trans-hydroxytamoxifen . D0B4VV
Tseram . D0W1YZ
Zeranol . DB11478
[5-hydroxy-2-(4-hydroxyphenyl)-1-benzofuran-7-yl]Acetonitrile . DB06927
Withdrawn from market
Click To Hide/Show 3 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Bithionol Small molecular drug D0QQ1J
Chlorotrianisene Small molecular drug D0X0KJ
Hexestrol Small molecular drug D0C4FT
Discontinued
Click To Hide/Show 20 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Droloxifene Small molecular drug D0R2JS
Em-800 Small molecular drug D0MU0S
Era-923 Small molecular drug D0R8TB
He2100 Small molecular drug D08DZZ
Hexestrol Small molecular drug DB07931
Ici-164384 Small molecular drug D09AAM
Idoxifene Small molecular drug D0GR2J
Ly-117018 Small molecular drug D0SM0J
Miproxifene Small molecular drug D02VFB
Mx-4509 Small molecular drug D05BCA
Panomifene Small molecular drug D04HVB
Stanolone Small molecular drug DB02901
Tamoxifen Methyl Iodide Small molecular drug D0J4ZH
Zindoxifene Small molecular drug D0TR4Z
Zk-119010 Small molecular drug D0H5CV
Hrt . D0B6HS
Iogen . D01OML
Np-50301 . D01AXT
Serm-3339 . D04MNL
Sr-90067 . D04BIG

References

1 From chemoproteomic-detected amino acids to genomic coordinates: insights into precise multi-omic data integration. Mol Syst Biol. 2021 Feb;17(2):e9840. doi: 10.15252/msb.20209840.
Mass spectrometry data entry: PXD022151
2 DrugMap: A quantitative pan-cancer analysis of cysteine ligandability. Cell. 2024 May 9;187(10):2536-2556.e30. doi: 10.1016/j.cell.2024.03.027. Epub 2024 Apr 22.
Mass spectrometry data entry: PXD047840
3 Total Synthesis and Target Identification of the Curcusone Diterpenes. J Am Chem Soc. 2021 Mar 24;143(11):4379-4386. doi: 10.1021/jacs.1c00557. Epub 2021 Mar 11.
4 N-Acryloylindole-alkyne (NAIA) enables imaging and profiling new ligandable cysteines and oxidized thiols by chemoproteomics. Nat Commun. 2023 Jun 15;14(1):3564. doi: 10.1038/s41467-023-39268-w.
Mass spectrometry data entry: PXD041264