Details of the Target
General Information of Target
| Target ID | LDTP01976 | |||||
|---|---|---|---|---|---|---|
| Target Name | Statherin (STATH) | |||||
| Gene Name | STATH | |||||
| Gene ID | 6779 | |||||
| Synonyms |
Statherin |
|||||
| 3D Structure | ||||||
| Sequence |
MKFLVFAFILALMVSMIGADSSEEKFLRRIGRFGYGYGPYQPVPEQPLYPQPYQPQYQQY
TF |
|||||
| Target Bioclass |
Transporter and channel
|
|||||
| Family |
Histatin/statherin family
|
|||||
| Subcellular location |
Secreted
|
|||||
| Function |
Salivary protein that stabilizes saliva supersaturated with calcium salts by inhibiting the precipitation of calcium phosphate salts. It also modulates hydroxyapatite crystal formation on the tooth surface.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
AZ-9 Probe Info |
![]() |
10.00 | LDD2155 | [1] | |
Competitor(s) Related to This Target
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Enzyme
Transporter and channel
Transcription factor
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Paired-like homeodomain transcription factor LEUTX (LEUTX) | Paired homeobox family | A8MZ59 | |||
| Transcription factor A, mitochondrial (TFAM) | . | Q00059 | |||
GPCR
Other

