Details of the Target

General Information of Target

Target ID LDTP01536
Target Name Apolipoprotein L3 (APOL3)
Gene Name APOL3
Gene ID 80833
Synonyms
Apolipoprotein L3; Apolipoprotein L-III; ApoL-III; TNF-inducible protein CG12-1; CG12_1
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MGLGQGWGWEASCFACLIRSCCQVVTFTFPFGFQGISQSLENVSGYYADARLEVGSTQLR
TAGSCSHSFKRSFLEKKRFTEEATKYFRERVSPVHLQILLTNNEAWKRFVTAAELPRDEA
DALYEALKKLRTYAAIEDEYVQQKDEQFREWFLKEFPQVKRKIQESIEKLRALANGIEEV
HRGCTISNVVSSSTGAASGIMSLAGLVLAPFTAGTSLALTAAGVGLGAASAVTGITTSIV
EHSYTSSAEAEASRLTATSIDRLKVFKEVMRDITPNLLSLLNNYYEATQTIGSEIRAIRQ
ARARARLPVTTWRISAGSGGQAERTIAGTTRAVSRGARILSATTSGIFLALDVVNLVYES
KHLHEGAKSASAEELRRQAQELEENLMELTQIYQRLNPCHTH
Target Bioclass
Other
Family
Apolipoprotein L family
Subcellular location
Cytoplasm
Function May affect the movement of lipids in the cytoplasm or allow the binding of lipids to organelles.
Uniprot ID
O95236
Ensemble ID
ENST00000349314.6
HGNC ID
HGNC:14868

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 3 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
DBIA
 Probe Info  		C399(1.92)  LDD3310  [1]
YY4-yne
 Probe Info  		2.79  LDD0400  [2]
IA-alkyne
 Probe Info  		N.A.  LDD0167  [3]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0625  F8 Ramos C399(1.30)  LDD2187  [4]
 LDCM0572  Fragment10 Ramos C399(1.61)  LDD2189  [4]
 LDCM0574  Fragment12 Ramos C399(0.74)  LDD2191  [4]
 LDCM0576  Fragment14 Ramos C399(0.97)  LDD2193  [4]
 LDCM0579  Fragment20 Ramos C399(0.82)  LDD2194  [4]
 LDCM0580  Fragment21 Ramos C399(0.80)  LDD2195  [4]
 LDCM0582  Fragment23 Ramos C399(0.92)  LDD2196  [4]
 LDCM0578  Fragment27 Ramos C399(0.75)  LDD2197  [4]
 LDCM0586  Fragment28 Ramos C399(0.72)  LDD2198  [4]
 LDCM0589  Fragment31 Ramos C399(0.83)  LDD2200  [4]
 LDCM0590  Fragment32 Ramos C399(1.11)  LDD2201  [4]
 LDCM0596  Fragment38 Ramos C399(0.81)  LDD2203  [4]
 LDCM0566  Fragment4 Ramos C399(0.84)  LDD2184  [4]
 LDCM0614  Fragment56 Ramos C399(1.01)  LDD2205  [4]
 LDCM0569  Fragment7 Ramos C399(1.02)  LDD2186  [4]
 LDCM0571  Fragment9 Ramos C399(0.95)  LDD2188  [4]
 LDCM0022  KB02 697 C399(2.10)  LDD2245  [1]
 LDCM0023  KB03 Ramos C399(0.65)  LDD2183  [4]
 LDCM0024  KB05 COLO792 C399(1.92)  LDD3310  [1]
 LDCM0154  YY4 T cell 2.79  LDD0400  [2]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 2 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Very long chain fatty acid elongase 4 (ELOVL4) ELO family Q9GZR5
E3 ubiquitin-protein ligase RNF19B (RNF19B) RBR family Q6ZMZ0
Transporter and channel
Click To Hide/Show 9 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Solute carrier family 7 member 14 (SLC7A14) Cationic amino acid transporter (CAT) (TC 2.A.3.3) family Q8TBB6
Gap junction alpha-8 protein (GJA8) Connexin family P48165
Gap junction beta-1 protein (GJB1) Connexin family P08034
Gap junction gamma-1 protein (GJC1) Connexin family P36383
Neutral amino acid transporter B(0) (SLC1A5) Dicarboxylate/amino acid:cation symporter (DAACS) (TC 2.A.23) family Q15758
LHFPL tetraspan subfamily member 5 protein (LHFPL5) LHFP family Q8TAF8
Major facilitator superfamily domain-containing protein 6 (MFSD6) MFSD6 family Q6ZSS7
Peripheral myelin protein 22 (PMP22) PMP-22/EMP/MP20 family Q01453
Syntaxin-1A (STX1A) Syntaxin family Q16623
GPCR
Click To Hide/Show 2 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Probable G-protein coupled receptor 152 (GPR152) G-protein coupled receptor 1 family Q8TDT2
G-protein coupled receptor family C group 5 member D (GPRC5D) G-protein coupled receptor 3 family Q9NZD1
Cytokine and receptor
Click To Hide/Show 2 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Interleukin-7 receptor subunit alpha (IL7R) Type I cytokine receptor family P16871
Tumor necrosis factor receptor superfamily member 10D (TNFRSF10D) . Q9UBN6
Other
Click To Hide/Show 8 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Gap junction beta-5 protein (GJB5) Connexin family O95377
Protein kish-B (TMEM167B) KISH family Q9NRX6
Neurocalcin-delta (NCALD) Recoverin family P61601
Beta-sarcoglycan (SGCB) Sarcoglycan beta/delta/gamma/zeta family Q16585
Complex I assembly factor TIMMDC1, mitochondrial (TIMMDC1) Tim17/Tim22/Tim23 family Q9NPL8
Fetal and adult testis-expressed transcript protein (FATE1) . Q969F0
Leucine-rich repeat-containing protein 25 (LRRC25) . Q8N386
Transmembrane protein 52B (TMEM52B) . Q4KMG9

References

1 DrugMap: A quantitative pan-cancer analysis of cysteine ligandability. Cell. 2024 May 9;187(10):2536-2556.e30. doi: 10.1016/j.cell.2024.03.027. Epub 2024 Apr 22.
Mass spectrometry data entry: PXD047840
2 A Chemical Proteomic Probe for the Mitochondrial Pyruvate Carrier Complex. Angew Chem Int Ed Engl. 2020 Mar 2;59(10):3896-3899. doi: 10.1002/anie.201914391. Epub 2020 Feb 11.
3 SP3-FAIMS Chemoproteomics for High-Coverage Profiling of the Human Cysteinome*. Chembiochem. 2021 May 14;22(10):1841-1851. doi: 10.1002/cbic.202000870. Epub 2021 Feb 18.
Mass spectrometry data entry: PXD023056 , PXD023059 , PXD023058 , PXD023057 , PXD023060
4 Site-specific quantitative cysteine profiling with data-independent acquisition-based mass spectrometry. Methods Enzymol. 2023;679:295-322. doi: 10.1016/bs.mie.2022.07.037. Epub 2022 Sep 7.
Mass spectrometry data entry: PXD027578