Details of the Target
General Information of Target
| Target ID | LDTP01457 | |||||
|---|---|---|---|---|---|---|
| Target Name | Dickkopf-related protein 1 (DKK1) |
|
||||
| Gene Name | DKK1 | |||||
| Gene ID | 22943 | |||||
| Synonyms |
Dickkopf-related protein 1; Dickkopf-1; Dkk-1; hDkk-1; SK |
|||||
| 3D Structure | ||||||
| Sequence |
MMALGAAGATRVFVAMVAAALGGHPLLGVSATLNSVLNSNAIKNLPPPLGGAAGHPGSAV
SAAPGILYPGGNKYQTIDNYQPYPCAEDEECGTDEYCASPTRGGDAGVQICLACRKRRKR CMRHAMCCPGNYCKNGICVSSDQNHFRGEIEETITESFGNDHSTLDGYSRRTTLSSKMYH TKGQEGSVCLRSSDCASGLCCARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCG EGLSCRIQKDHHQASNSSRLHTCQRH |
|||||
| Target Type |
Clinical trial
|
|||||
| Target Bioclass |
Other
|
|||||
| Family |
Dickkopf family
|
|||||
| Subcellular location |
Secreted
|
|||||
| Function |
Antagonizes canonical Wnt signaling by inhibiting LRP5/6 interaction with Wnt and by forming a ternary complex with the transmembrane protein KREMEN that promotes internalization of LRP5/6. DKKs play an important role in vertebrate development, where they locally inhibit Wnt regulated processes such as antero-posterior axial patterning, limb development, somitogenesis and eye formation. In the adult, Dkks are implicated in bone formation and bone disease, cancer and Alzheimer disease. Inhibits the pro-apoptotic function of KREMEN1 in a Wnt-independent manner, and has anti-apoptotic activity.
|
|||||
| TTD ID | ||||||
| Uniprot ID | ||||||
| DrugMap ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
| ChEMBL ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
FBPP2 Probe Info |
 |
3.21 | LDD0318 | [1] | |
|
STPyne Probe Info |
 |
K222(7.85) | LDD0277 | [2] | |
|
DBIA Probe Info |
 |
C189(1.53) | LDD3316 | [3] | |
|
CY4 Probe Info |
 |
C220(0.00); H223(0.00) | LDD0247 | [4] | |
|
NAIA_5 Probe Info |
 |
C263(0.00); C189(0.00); C138(0.00) | LDD2223 | [5] | |
Competitor(s) Related to This Target
The Interaction Atlas With This Target
References