Details of the Target
General Information of Target
| Target ID | LDTP01256 | |||||
|---|---|---|---|---|---|---|
| Target Name | Syntaxin-11 (STX11) | |||||
| Gene Name | STX11 | |||||
| Gene ID | 8676 | |||||
| Synonyms |
Syntaxin-11 |
|||||
| 3D Structure | ||||||
| Sequence |
MKDRLAELLDLSKQYDQQFPDGDDEFDSPHEDIVFETDHILESLYRDIRDIQDENQLLVA
DVKRLGKQNARFLTSMRRLSSIKRDTNSIAKAIKARGEVIHCKLRAMKELSEAAEAQHGP HSAVARISRAQYNALTLTFQRAMHDYNQAEMKQRDNCKIRIQRQLEIMGKEVSGDQIEDM FEQGKWDVFSENLLADVKGARAALNEIESRHRELLRLESRIRDVHELFLQMAVLVEKQAD TLNVIELNVQKTVDYTGQAKAQVRKAVQYEEKNPCRTLCCFCCPCLK |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
Syntaxin family
|
|||||
| Subcellular location |
Membrane
|
|||||
| Function | SNARE that acts to regulate protein transport between late endosomes and the trans-Golgi network. | |||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
AHL-Pu-1 Probe Info |
![]() |
C102(4.60) | LDD0171 | [1] | |
|
IA-alkyne Probe Info |
![]() |
C102(9.30) | LDD1705 | [2] | |
|
DBIA Probe Info |
![]() |
C102(1.05) | LDD1513 | [3] | |
|
TFBX Probe Info |
![]() |
N.A. | LDD0148 | [4] | |
Competitor(s) Related to This Target
| Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
|---|---|---|---|---|---|
| LDCM0026 | 4SU-RNA+native RNA | DM93 | C102(4.60) | LDD0171 | [1] |
| LDCM0270 | AC15 | HEK-293T | C102(1.05) | LDD1513 | [3] |
| LDCM0283 | AC23 | HEK-293T | C102(0.97) | LDD1522 | [3] |
| LDCM0292 | AC31 | HEK-293T | C102(0.91) | LDD1531 | [3] |
| LDCM0300 | AC39 | HEK-293T | C102(1.03) | LDD1539 | [3] |
| LDCM0309 | AC47 | HEK-293T | C102(1.02) | LDD1548 | [3] |
| LDCM0318 | AC55 | HEK-293T | C102(1.03) | LDD1557 | [3] |
| LDCM0327 | AC63 | HEK-293T | C102(1.05) | LDD1566 | [3] |
| LDCM0334 | AC7 | HEK-293T | C102(0.99) | LDD1568 | [3] |
| LDCM0379 | CL11 | HEK-293T | C102(1.01) | LDD1583 | [3] |
| LDCM0411 | CL23 | HEK-293T | C102(1.08) | LDD1615 | [3] |
| LDCM0424 | CL35 | HEK-293T | C102(1.00) | LDD1628 | [3] |
| LDCM0437 | CL47 | HEK-293T | C102(1.09) | LDD1641 | [3] |
| LDCM0450 | CL59 | HEK-293T | C102(1.12) | LDD1653 | [3] |
| LDCM0464 | CL71 | HEK-293T | C102(1.04) | LDD1667 | [3] |
| LDCM0477 | CL83 | HEK-293T | C102(0.89) | LDD1680 | [3] |
| LDCM0490 | CL95 | HEK-293T | C102(0.98) | LDD1693 | [3] |
| LDCM0024 | KB05 | T cell | C102(9.30) | LDD1705 | [2] |
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Enzyme
Transporter and channel
Transcription factor
Other
References




