Details of the Target

General Information of Target

Target ID LDTP01256
Target Name Syntaxin-11 (STX11)
Gene Name STX11
Gene ID 8676
Synonyms
Syntaxin-11
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MKDRLAELLDLSKQYDQQFPDGDDEFDSPHEDIVFETDHILESLYRDIRDIQDENQLLVA
DVKRLGKQNARFLTSMRRLSSIKRDTNSIAKAIKARGEVIHCKLRAMKELSEAAEAQHGP
HSAVARISRAQYNALTLTFQRAMHDYNQAEMKQRDNCKIRIQRQLEIMGKEVSGDQIEDM
FEQGKWDVFSENLLADVKGARAALNEIESRHRELLRLESRIRDVHELFLQMAVLVEKQAD
TLNVIELNVQKTVDYTGQAKAQVRKAVQYEEKNPCRTLCCFCCPCLK
Target Bioclass
Other
Family
Syntaxin family
Subcellular location
Membrane
Function SNARE that acts to regulate protein transport between late endosomes and the trans-Golgi network.
Uniprot ID
O75558
Ensemble ID
ENST00000367568.5
HGNC ID
HGNC:11429

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 4 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
AHL-Pu-1
 Probe Info  		C102(4.60)  LDD0171  [1]
IA-alkyne
 Probe Info  		C102(9.30)  LDD1705  [2]
DBIA
 Probe Info  		C102(1.05)  LDD1513  [3]
TFBX
 Probe Info  		N.A.  LDD0148  [4]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0026  4SU-RNA+native RNA DM93 C102(4.60)  LDD0171  [1]
 LDCM0270  AC15 HEK-293T C102(1.05)  LDD1513  [3]
 LDCM0283  AC23 HEK-293T C102(0.97)  LDD1522  [3]
 LDCM0292  AC31 HEK-293T C102(0.91)  LDD1531  [3]
 LDCM0300  AC39 HEK-293T C102(1.03)  LDD1539  [3]
 LDCM0309  AC47 HEK-293T C102(1.02)  LDD1548  [3]
 LDCM0318  AC55 HEK-293T C102(1.03)  LDD1557  [3]
 LDCM0327  AC63 HEK-293T C102(1.05)  LDD1566  [3]
 LDCM0334  AC7 HEK-293T C102(0.99)  LDD1568  [3]
 LDCM0379  CL11 HEK-293T C102(1.01)  LDD1583  [3]
 LDCM0411  CL23 HEK-293T C102(1.08)  LDD1615  [3]
 LDCM0424  CL35 HEK-293T C102(1.00)  LDD1628  [3]
 LDCM0437  CL47 HEK-293T C102(1.09)  LDD1641  [3]
 LDCM0450  CL59 HEK-293T C102(1.12)  LDD1653  [3]
 LDCM0464  CL71 HEK-293T C102(1.04)  LDD1667  [3]
 LDCM0477  CL83 HEK-293T C102(0.89)  LDD1680  [3]
 LDCM0490  CL95 HEK-293T C102(0.98)  LDD1693  [3]
 LDCM0024  KB05 T cell C102(9.30)  LDD1705  [2]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 13 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
5'-AMP-activated protein kinase subunit beta-2 (PRKAB2) 5'-AMP-activated protein kinase beta subunit family O43741
Phenylalanine--tRNA ligase, mitochondrial (FARS2) Class-II aminoacyl-tRNA synthetase family O95363
Histone acetyltransferase KAT5 (KAT5) MYST (SAS/MOZ) family Q92993
Transcriptional adapter 3 (TADA3) NGG1 family O75528
Protein N-terminal glutamine amidohydrolase (NTAQ1) NTAQ1 family Q96HA8
Beta-secretase 2 (BACE2) Peptidase A1 family Q9Y5Z0
Kallikrein-6 (KLK6) Peptidase S1 family Q92876
Serine/threonine-protein kinase N1 (PKN1) AGC Ser/Thr protein kinase family Q16512
Serine/threonine-protein kinase PAK 1 (PAK1) STE Ser/Thr protein kinase family Q13153
Dual specificity phosphatase 29 (DUSP29) Protein-tyrosine phosphatase family Q68J44
E3 ubiquitin-protein ligase RNF8 (RNF8) RNF8 family O76064
E3 ubiquitin-protein ligase TRIM41 (TRIM41) TRIM/RBCC family Q8WV44
LON peptidase N-terminal domain and RING finger protein 1 (LONRF1) . Q17RB8
Transporter and channel
Click To Hide/Show 8 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
mRNA export factor GLE1 (GLE1) GLE1 family Q53GS7
Alpha-crystallin A chain (CRYAA) Small heat shock protein (HSP20) family P02489
Synaptosomal-associated protein 23 (SNAP23) SNAP-25 family O00161
RNA-binding protein with serine-rich domain 1 (RNPS1) Splicing factor SR family Q15287
Syntaxin-binding protein 1 (STXBP1) STXBP/unc-18/SEC1 family P61764
Syntaxin-1A (STX1A) Syntaxin family Q16623
Syntaxin-4 (STX4) Syntaxin family Q12846
Sodium channel modifier 1 (SCNM1) . Q9BWG6
Transcription factor
Click To Hide/Show 9 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Homeobox protein Hox-A1 (HOXA1) Antp homeobox family P49639
Zinc finger protein Aiolos (IKZF3) Ikaros C2H2-type zinc-finger protein family Q9UKT9
Zinc finger protein 19 (ZNF19) Krueppel C2H2-type zinc-finger protein family P17023
Zinc finger protein 417 (ZNF417) Krueppel C2H2-type zinc-finger protein family Q8TAU3
Zinc finger protein 587 (ZNF587) Krueppel C2H2-type zinc-finger protein family Q96SQ5
Krueppel-like factor 11 (KLF11) Sp1 C2H2-type zinc-finger protein family O14901
Homeobox protein MOX-2 (MEOX2) . P50222
SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1 (SMARCE1) . Q969G3
Transcription factor 4 (TCF4) . P15884
Other
Click To Hide/Show 51 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Beta-crystallin A4 (CRYBA4) Beta/gamma-crystallin family P53673
Biogenesis of lysosome-related organelles complex 1 subunit 6 (BLOC1S6) BLOC1S6 family Q9UL45
Bystin (BYSL) Bystin family Q13895
Collagen and calcium-binding EGF domain-containing protein 1 (CCBE1) CCBE1 family Q6UXH8
Cerebellar degeneration-related protein 2-like (CDR2L) CDR2 family Q86X02
CWF19-like protein 2 (CWF19L2) CWF19 family Q2TBE0
Translation initiation factor eIF2B subunit epsilon (EIF2B5) EIF-2B gamma/epsilon subunits family Q13144
Probable RNA-binding protein EIF1AD (EIF1AD) EIF1AD family Q8N9N8
Protein FAM110A (FAM110A) FAM110 family Q9BQ89
Protein FAM161A (FAM161A) FAM161 family Q3B820
Protein FAM161B (FAM161B) FAM161 family Q96MY7
Protein FAM74A4/A6 (FAM74A4; FAM74A6) FAM74 family Q5TZK3
Protein FAM90A1 (FAM90A1) FAM90 family Q86YD7
. GOLGA8 family Q08AF8
Putative golgin subfamily A member 8D (GOLGA8DP) GOLGA8 family Q0D2H9
HAUS augmin-like complex subunit 1 (HAUS1) HAUS1 family Q96CS2
Keratin, type II cytoskeletal 75 (KRT75) Intermediate filament family O95678
Kinesin light chain 3 (KLC3) Kinesin light chain family Q6P597
Protein mago nashi homolog 2 (MAGOHB) Mago nashi family Q96A72
Methyl-CpG-binding domain protein 3-like 1 (MBD3L1) MBD3L family Q8WWY6
Harmonin-binding protein USHBP1 (USHBP1) MCC family Q8N6Y0
Microfibrillar-associated protein 1 (MFAP1) MFAP1 family P55081
Protein Mis18-alpha (MIS18A) Mis18 family Q9NYP9
Kinetochore protein NDC80 homolog (NDC80) NDC80/HEC1 family O14777
Alpha-2-macroglobulin (A2M) Protease inhibitor I39 (alpha-2-macroglobulin) family P01023
Pre-mRNA-splicing factor 18 (PRPF18) PRP18 family Q99633
U4/U6 small nuclear ribonucleoprotein Prp31 (PRPF31) PRP31 family Q8WWY3
DNA repair protein RAD51 homolog 4 (RAD51D) RecA family O75771
Suppressor of IKBKE 1 (SIKE1) SIKE family Q9BRV8
Syntaxin-binding protein 2 (STXBP2) STXBP/unc-18/SEC1 family Q15833
Transcription elongation factor A protein 2 (TCEA2) TFS-II family Q15560
Vacuolar protein sorting-associated protein 52 homolog (VPS52) VPS52 family Q8N1B4
TLE family member 5 (TLE5) WD repeat Groucho/TLE family Q08117
AFG2-interacting ribosome maturation factor (AIRIM) . Q9NX04
Axin-1 (AXIN1) . O15169
Axin-2 (AXIN2) . Q9Y2T1
BTB/POZ domain-containing protein KCTD9 (KCTD9) . Q7L273
Caspase recruitment domain-containing protein 9 (CARD9) . Q9H257
Cell division cycle-associated 7-like protein (CDCA7L) . Q96GN5
Coiled-coil domain-containing protein 120 (CCDC120) . Q96HB5
Coiled-coil domain-containing protein 125 (CCDC125) . Q86Z20
Coiled-coil domain-containing protein 184 (CCDC184) . Q52MB2
Hepatocyte growth factor-regulated tyrosine kinase substrate (HGS) . O14964
Leukocyte receptor cluster member 1 (LENG1) . Q96BZ8
Methyl-CpG-binding protein 2 (MECP2) . P51608
Phostensin (PPP1R18) . Q6NYC8
SH2 domain-containing protein 4A (SH2D4A) . Q9H788
SHC-transforming protein 3 (SHC3) . Q92529
Sprouty-related, EVH1 domain-containing protein 1 (SPRED1) . Q7Z699
Testis-specific protein 10-interacting protein (TSGA10IP) . Q3SY00
Zinc finger CCHC domain-containing protein 10 (ZCCHC10) . Q8TBK6

References

1 Chemoproteomic capture of RNA binding activity in living cells. Nat Commun. 2023 Oct 7;14(1):6282. doi: 10.1038/s41467-023-41844-z.
Mass spectrometry data entry: PXD044625
2 An Activity-Guided Map of Electrophile-Cysteine Interactions in Primary Human T Cells. Cell. 2020 Aug 20;182(4):1009-1026.e29. doi: 10.1016/j.cell.2020.07.001. Epub 2020 Jul 29.
3 Accelerating multiplexed profiling of protein-ligand interactions: High-throughput plate-based reactive cysteine profiling with minimal input. Cell Chem Biol. 2024 Mar 21;31(3):565-576.e4. doi: 10.1016/j.chembiol.2023.11.015. Epub 2023 Dec 19.
Mass spectrometry data entry: PXD044402
4 Chemoproteomic Profiling by Cysteine Fluoroalkylation Reveals Myrocin G as an Inhibitor of the Nonhomologous End Joining DNA Repair Pathway. J Am Chem Soc. 2021 Dec 8;143(48):20332-20342. doi: 10.1021/jacs.1c09724. Epub 2021 Nov 24.
Mass spectrometry data entry: PXD029255