Details of the Target
General Information of Target
| Target ID | LDTP01239 | |||||
|---|---|---|---|---|---|---|
| Target Name | Serine/arginine-rich splicing factor 10 (SRSF10) | |||||
| Gene Name | SRSF10 | |||||
| Gene ID | 10772 | |||||
| Synonyms |
FUSIP1; FUSIP2; SFRS13A; TASR; Serine/arginine-rich splicing factor 10; 40 kDa SR-repressor protein; SRrp40; FUS-interacting serine-arginine-rich protein 1; Splicing factor SRp38; Splicing factor, arginine/serine-rich 13A; TLS-associated protein with Ser-Arg repeats; TASR; TLS-associated protein with SR repeats; TLS-associated serine-arginine protein; TLS-associated SR protein
|
|||||
| 3D Structure | ||||||
| Sequence |
MSRYLRPPNTSLFVRNVADDTRSEDLRREFGRYGPIVDVYVPLDFYTRRPRGFAYVQFED
VRDAEDALHNLDRKWICGRQIEIQFAQGDRKTPNQMKAKEGRNVYSSSRYDDYDRYRRSR SRSYERRRSRSRSFDYNYRRSYSPRNSRPTGRPRRSRSHSDNDRFKHRNRSFSRSKSNSR SRSKSQPKKEMKAKSRSRSASHTKTRGTSKTDSKTHYKSGSRYEKESRKKEPPRSKSQSR SQSRSRSKSRSRSWTSPKSSGH |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
Splicing factor SR family
|
|||||
| Subcellular location |
Nucleus speckle
|
|||||
| Function |
Splicing factor that in its dephosphorylated form acts as a general repressor of pre-mRNA splicing. Seems to interfere with the U1 snRNP 5'-splice recognition of SNRNP70. Required for splicing repression in M-phase cells and after heat shock. Also acts as a splicing factor that specifically promotes exon skipping during alternative splicing. Interaction with YTHDC1, a RNA-binding protein that recognizes and binds N6-methyladenosine (m6A)-containing RNAs, prevents SRSF10 from binding to its mRNA-binding sites close to m6A-containing regions, leading to inhibit exon skipping during alternative splicing. May be involved in regulation of alternative splicing in neurons, with isoform 1 acting as a positive and isoform 3 as a negative regulator.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
m-APA Probe Info |
 |
15.00 | LDD0402 | [1] | |
|
CY-1 Probe Info |
 |
100.00 | LDD0243 | [2] | |
|
TH211 Probe Info |
 |
Y33(20.00); Y46(8.02) | LDD0260 | [3] | |
|
STPyne Probe Info |
 |
K204(5.64); K214(9.13); K218(7.08) | LDD0277 | [4] | |
|
DBIA Probe Info |
 |
C77(1.48) | LDD3397 | [5] | |
|
Acrolein Probe Info |
 |
N.A. | LDD0227 | [6] | |
|
5E-2FA Probe Info |
 |
N.A. | LDD2235 | [7] | |
|
IA-alkyne Probe Info |
 |
N.A. | LDD0165 | [8] | |
|
SF Probe Info |
 |
Y105(0.00); Y136(0.00); Y4(0.00); Y113(0.00) | LDD0028 | [9] | |
|
Phosphinate-6 Probe Info |
 |
N.A. | LDD0018 | [10] | |
|
AOyne Probe Info |
 |
15.00 | LDD0443 | [11] | |
PAL-AfBPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
C338 Probe Info |
 |
12.13 | LDD2001 | [12] | |
|
FFF probe12 Probe Info |
 |
5.53 | LDD0473 | [13] | |
|
FFF probe2 Probe Info |
 |
10.75 | LDD0463 | [13] | |
|
STS-2 Probe Info |
 |
N.A. | LDD0138 | [14] | |
Competitor(s) Related to This Target
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Enzyme
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| SRSF protein kinase 2 (SRPK2) | CMGC Ser/Thr protein kinase family | P78362 | |||
| Dual specificity protein kinase CLK3 (CLK3) | CMGC Ser/Thr protein kinase family | P49761 | |||
Transporter and channel
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| RNA-binding protein with serine-rich domain 1 (RNPS1) | Splicing factor SR family | Q15287 | |||
References