Details of the Target

General Information of Target

Target ID LDTP01036
Target Name Leupaxin (LPXN)
Gene Name LPXN
Gene ID 9404
Synonyms
LDLP; Leupaxin
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MEELDALLEELERSTLQDSDEYSNPAPLPLDQHSRKETNLDETSEILSIQDNTSPLPAQL
VYTTNIQELNVYSEAQEPKESPPPSKTSAAAQLDELMAHLTEMQAKVAVRADAGKKHLPD
KQDHKASLDSMLGGLEQELQDLGIATVPKGHCASCQKPIAGKVIHALGQSWHPEHFVCTH
CKEEIGSSPFFERSGLAYCPNDYHQLFSPRCAYCAAPILDKVLTAMNQTWHPEHFFCSHC
GEVFGAEGFHEKDKKPYCRKDFLAMFSPKCGGCNRPVLENYLSAMDTVWHPECFVCGDCF
TSFSTGSFFELDGRPFCELHYHHRRGTLCHGCGQPITGRCISAMGYKFHPEHFVCAFCLT
QLSKGIFREQNDKTYCQPCFNKLFPL
Target Bioclass
Other
Family
Paxillin family
Subcellular location
Cytoplasm
Function
Transcriptional coactivator for androgen receptor (AR) and serum response factor (SRF). Contributes to the regulation of cell adhesion, spreading and cell migration and acts as a negative regulator in integrin-mediated cell adhesion events. Suppresses the integrin-induced tyrosine phosphorylation of paxillin (PXN). May play a critical role as an adapter protein in the formation of the adhesion zone in osteoclasts. Negatively regulates B-cell antigen receptor (BCR) signaling.
Uniprot ID
O60711
Ensemble ID
ENST00000395074.7
HGNC ID
HGNC:14061

Target Site Mutations in Different Cell Lines

Cell line Mutation details Probe for labeling this protein in this cell
NCIH1703 SNV: p.H151N DBIA    Probe Info 
NCIH2286 SNV: p.E68Ter .

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 8 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
TH211
 Probe Info  		Y375(20.00)  LDD0260  [1]
DBIA
 Probe Info  		C204(0.92)  LDD3310  [2]
MCL-4
 Probe Info  		2.50  LDD0049  [3]
HHS-475
 Probe Info  		Y203(1.10)  LDD0264  [4]
4-Iodoacetamidophenylacetylene
 Probe Info  		C340(0.00); C199(0.00); C358(0.00); C355(0.00)  LDD0038  [5]
IA-alkyne
 Probe Info  		C199(0.00); C340(0.00); C358(0.00); C355(0.00)  LDD0036  [5]
Lodoacetamide azide
 Probe Info  		C199(0.00); C340(0.00); C258(0.00); C358(0.00)  LDD0037  [5]
NAIA_4
 Probe Info  		N.A.  LDD2226  [6]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0625  F8 Ramos C199(1.11); C258(2.95); C340(1.22)  LDD2187  [7]
 LDCM0572  Fragment10 Ramos C199(0.55); C340(0.78)  LDD2189  [7]
 LDCM0573  Fragment11 Ramos 0.47; C199(0.02); C340(0.10)  LDD2190  [7]
 LDCM0574  Fragment12 Ramos C199(0.63); C340(0.88)  LDD2191  [7]
 LDCM0575  Fragment13 Ramos C199(1.07); C340(1.44)  LDD2192  [7]
 LDCM0576  Fragment14 Ramos 0.69; C199(0.80); C258(0.76); C340(0.99)  LDD2193  [7]
 LDCM0579  Fragment20 Ramos C199(0.55); C340(0.87)  LDD2194  [7]
 LDCM0580  Fragment21 Ramos C199(0.96); C340(1.03)  LDD2195  [7]
 LDCM0582  Fragment23 Ramos C199(1.09); C340(1.20)  LDD2196  [7]
 LDCM0578  Fragment27 Ramos C199(1.06); C340(1.15)  LDD2197  [7]
 LDCM0586  Fragment28 Ramos 0.94; C199(0.81); C258(0.73); C340(5.30)  LDD2198  [7]
 LDCM0588  Fragment30 Ramos C199(0.94); C340(1.51)  LDD2199  [7]
 LDCM0589  Fragment31 Ramos C199(1.06); C340(0.80)  LDD2200  [7]
 LDCM0590  Fragment32 Ramos C199(0.52); C340(0.75)  LDD2201  [7]
 LDCM0468  Fragment33 Ramos C199(0.84); C340(0.99)  LDD2202  [7]
 LDCM0596  Fragment38 Ramos C199(0.81); C340(1.03)  LDD2203  [7]
 LDCM0566  Fragment4 Ramos C199(0.67); C258(0.74); C340(0.83)  LDD2184  [7]
 LDCM0610  Fragment52 Ramos C199(1.13)  LDD2204  [7]
 LDCM0614  Fragment56 Ramos C199(1.11); C340(1.30)  LDD2205  [7]
 LDCM0569  Fragment7 Ramos 0.32; C199(0.49); C258(0.67); C340(0.67)  LDD2186  [7]
 LDCM0571  Fragment9 Ramos C199(0.53); C340(0.93)  LDD2188  [7]
 LDCM0116  HHS-0101 DM93 Y203(1.10)  LDD0264  [4]
 LDCM0117  HHS-0201 DM93 Y203(0.19)  LDD0265  [4]
 LDCM0118  HHS-0301 DM93 Y203(0.67)  LDD0266  [4]
 LDCM0120  HHS-0701 DM93 Y203(0.65)  LDD0268  [4]
 LDCM0022  KB02 Ramos 0.23; C199(0.44); C258(0.52); C340(0.75)  LDD2182  [7]
 LDCM0023  KB03 Jurkat C340(10.90)  LDD0315  [8]
 LDCM0024  KB05 COLO792 C204(0.92)  LDD3310  [2]
 LDCM0006  Micheliolide M9-ENL1 2.50  LDD0049  [3]
 LDCM0131  RA190 MM1.R C340(1.28)  LDD0304  [9]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 2 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Alanine--glyoxylate aminotransferase (AGXT) Class-V pyridoxal-phosphate-dependent aminotransferase family P21549
Tensin-2 (TNS2) PTEN phosphatase protein family Q63HR2
Transporter and channel
Click To Hide/Show 2 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Aquaporin-1 (AQP1) MIP/aquaporin (TC 1.A.8) family P29972
Optineurin (OPTN) . Q96CV9
Transcription factor
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Homeobox protein Hox-C9 (HOXC9) Abd-B homeobox family P31274
Cytokine and receptor
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Transforming growth factor beta-1 proprotein (TGFB1) TGF-beta family P01137
Other
Click To Hide/Show 4 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Beta-taxilin (TXLNB) Taxilin family Q8N3L3
Pleckstrin homology domain-containing family H member 2 (PLEKHH2) . Q8IVE3
Pleckstrin homology domain-containing family N member 1 (PLEKHN1) . Q494U1
Rhombotin-1 (LMO1) . P25800

References

1 Chemoproteomic profiling of kinases in live cells using electrophilic sulfonyl triazole probes. Chem Sci. 2021 Jan 21;12(9):3295-3307. doi: 10.1039/d0sc06623k.
2 DrugMap: A quantitative pan-cancer analysis of cysteine ligandability. Cell. 2024 May 9;187(10):2536-2556.e30. doi: 10.1016/j.cell.2024.03.027. Epub 2024 Apr 22.
Mass spectrometry data entry: PXD047840
3 Comprehensive Structure-Activity Profiling of Micheliolide and its Targeted Proteome in Leukemia Cells via Probe-Guided Late-Stage C-H Functionalization. ACS Cent Sci. 2021 May 26;7(5):841-857. doi: 10.1021/acscentsci.0c01624. Epub 2021 Apr 28.
Mass spectrometry data entry: PXD024455
4 Discovery of a Cell-Active SuTEx Ligand of Prostaglandin Reductase 2. Chembiochem. 2021 Jun 15;22(12):2134-2139. doi: 10.1002/cbic.202000879. Epub 2021 Apr 29.
5 Enhancing Cysteine Chemoproteomic Coverage through Systematic Assessment of Click Chemistry Product Fragmentation. Anal Chem. 2022 Mar 8;94(9):3800-3810. doi: 10.1021/acs.analchem.1c04402. Epub 2022 Feb 23.
Mass spectrometry data entry: PXD028853
6 N-Acryloylindole-alkyne (NAIA) enables imaging and profiling new ligandable cysteines and oxidized thiols by chemoproteomics. Nat Commun. 2023 Jun 15;14(1):3564. doi: 10.1038/s41467-023-39268-w.
Mass spectrometry data entry: PXD041264
7 Site-specific quantitative cysteine profiling with data-independent acquisition-based mass spectrometry. Methods Enzymol. 2023;679:295-322. doi: 10.1016/bs.mie.2022.07.037. Epub 2022 Sep 7.
Mass spectrometry data entry: PXD027578
8 SP3-FAIMS Chemoproteomics for High-Coverage Profiling of the Human Cysteinome*. Chembiochem. 2021 May 14;22(10):1841-1851. doi: 10.1002/cbic.202000870. Epub 2021 Feb 18.
Mass spectrometry data entry: PXD023056 , PXD023059 , PXD023058 , PXD023057 , PXD023060
9 Physical and Functional Analysis of the Putative Rpn13 Inhibitor RA190. Cell Chem Biol. 2020 Nov 19;27(11):1371-1382.e6. doi: 10.1016/j.chembiol.2020.08.007. Epub 2020 Aug 27.