Details of the Target
General Information of Target
| Target ID | LDTP00829 | |||||
|---|---|---|---|---|---|---|
| Target Name | Regulator of G-protein signaling 10 (RGS10) | |||||
| Gene Name | RGS10 | |||||
| Gene ID | 6001 | |||||
| Synonyms |
Regulator of G-protein signaling 10; RGS10 |
|||||
| 3D Structure | ||||||
| Sequence |
MFNRAVSRLSRKRPPSDIHDSDGSSSSSHQSLKSTAKWAASLENLLEDPEGVKRFREFLK
KEFSEENVLFWLACEDFKKMQDKTQMQEKAKEIYMTFLSSKASSQVNVEGQSRLNEKILE EPHPLMFQKLQDQIFNLMKYDSYSRFLKSDLFLKHKRTEEEEEDLPDAQTAAKRASRIYN T |
|||||
| Target Bioclass |
Other
|
|||||
| Subcellular location |
Nucleus; Cytoplasm, cytosol
|
|||||
| Function |
Regulates G protein-coupled receptor signaling cascades, including signaling downstream of the muscarinic acetylcholine receptor CHRM2. Inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits, thereby driving them into their inactive GDP-bound form. Modulates the activity of potassium channels that are activated in response to CHRM2 signaling. Activity on GNAZ is inhibited by palmitoylation of the G-protein.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
STPyne Probe Info |
![]() |
K148(6.56); K154(8.19); K91(2.31) | LDD0277 | [1] | |
|
HHS-475 Probe Info |
![]() |
Y94(0.84); Y140(0.88) | LDD0264 | [2] | |
|
5E-2FA Probe Info |
![]() |
H123(0.00); H29(0.00) | LDD2235 | [3] | |
|
m-APA Probe Info |
![]() |
H29(0.00); H19(0.00) | LDD2231 | [3] | |
|
4-Iodoacetamidophenylacetylene Probe Info |
![]() |
N.A. | LDD0038 | [4] | |
|
IA-alkyne Probe Info |
![]() |
N.A. | LDD0036 | [4] | |
|
Lodoacetamide azide Probe Info |
![]() |
N.A. | LDD0037 | [4] | |
|
SF Probe Info |
![]() |
N.A. | LDD0028 | [5] | |
PAL-AfBPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
C003 Probe Info |
![]() |
13.45 | LDD1713 | [6] | |
Competitor(s) Related to This Target
| Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
|---|---|---|---|---|---|
| LDCM0116 | HHS-0101 | DM93 | Y94(0.84); Y140(0.88) | LDD0264 | [2] |
| LDCM0117 | HHS-0201 | DM93 | Y140(0.90); Y94(0.97) | LDD0265 | [2] |
| LDCM0118 | HHS-0301 | DM93 | Y94(0.85); Y140(1.26) | LDD0266 | [2] |
| LDCM0119 | HHS-0401 | DM93 | Y140(0.98); Y94(1.22) | LDD0267 | [2] |
| LDCM0120 | HHS-0701 | DM93 | Y94(1.20); Y140(1.25) | LDD0268 | [2] |
The Interaction Atlas With This Target
References









