Details of the Target

General Information of Target

Target ID LDTP00666
Target Name Transcription factor MafG (MAFG)
Gene Name MAFG
Gene ID 4097
Synonyms
Transcription factor MafG; V-maf musculoaponeurotic fibrosarcoma oncogene homolog G; hMAF
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MTTPNKGNKALKVKREPGENGTSLTDEELVTMSVRELNQHLRGLSKEEIVQLKQRRRTLK
NRGYAASCRVKRVTQKEELEKQKAELQQEVEKLASENASMKLELDALRSKYEALQTFART
VARSPVAPARGPLAAGLGPLVPGKVAATSVITIVKSKTDARS
Target Bioclass
Transcription factor
Family
BZIP family, Maf subfamily
Subcellular location
Nucleus
Function
Since they lack a putative transactivation domain, the small Mafs behave as transcriptional repressors when they dimerize among themselves. However, they seem to serve as transcriptional activators by dimerizing with other (usually larger) basic-zipper proteins, such as NFE2, NFE2L1 and NFE2L2, and recruiting them to specific DNA-binding sites. Small Maf proteins heterodimerize with Fos and may act as competitive repressors of the NFE2L2 transcription factor. Transcription factor, component of erythroid-specific transcription factor NFE2L2. Activates globin gene expression when associated with NFE2L2. May be involved in signal transduction of extracellular H(+).
Uniprot ID
O15525
Ensemble ID
ENST00000357736.9
HGNC ID
HGNC:6781

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 4 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
BTD
 Probe Info  		C68(0.99)  LDD2099  [1]
4-Iodoacetamidophenylacetylene
 Probe Info  		N.A.  LDD0038  [2]
IA-alkyne
 Probe Info  		N.A.  LDD0036  [2]
Lodoacetamide azide
 Probe Info  		N.A.  LDD0037  [2]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0524  2-Cyano-N-(2-morpholin-4-yl-ethyl)-acetamide MDA-MB-231 C68(0.98)  LDD2117  [1]
 LDCM0025  4SU-RNA HEK-293T C68(6.34)  LDD0371  [3]
 LDCM0026  4SU-RNA+native RNA HEK-293T C68(3.11)  LDD0372  [3]
 LDCM0625  F8 Ramos C68(0.87)  LDD2187  [4]
 LDCM0572  Fragment10 Ramos C68(1.15)  LDD2189  [4]
 LDCM0573  Fragment11 Ramos C68(0.22)  LDD2190  [4]
 LDCM0574  Fragment12 Ramos C68(0.70)  LDD2191  [4]
 LDCM0575  Fragment13 Ramos C68(0.97)  LDD2192  [4]
 LDCM0576  Fragment14 Ramos C68(0.69)  LDD2193  [4]
 LDCM0579  Fragment20 Ramos C68(0.81)  LDD2194  [4]
 LDCM0580  Fragment21 Ramos C68(0.86)  LDD2195  [4]
 LDCM0582  Fragment23 Ramos C68(0.92)  LDD2196  [4]
 LDCM0578  Fragment27 Ramos C68(0.85)  LDD2197  [4]
 LDCM0586  Fragment28 Ramos C68(0.56)  LDD2198  [4]
 LDCM0588  Fragment30 Ramos C68(1.13)  LDD2199  [4]
 LDCM0589  Fragment31 Ramos C68(0.74)  LDD2200  [4]
 LDCM0590  Fragment32 Ramos C68(1.05)  LDD2201  [4]
 LDCM0468  Fragment33 Ramos C68(0.95)  LDD2202  [4]
 LDCM0596  Fragment38 Ramos C68(0.80)  LDD2203  [4]
 LDCM0566  Fragment4 Ramos C68(0.66)  LDD2184  [4]
 LDCM0610  Fragment52 Ramos C68(1.25)  LDD2204  [4]
 LDCM0614  Fragment56 Ramos C68(1.01)  LDD2205  [4]
 LDCM0569  Fragment7 Ramos C68(0.58)  LDD2186  [4]
 LDCM0571  Fragment9 Ramos C68(0.89)  LDD2188  [4]
 LDCM0022  KB02 Ramos C68(1.11)  LDD2182  [4]
 LDCM0023  KB03 Ramos C68(0.79)  LDD2183  [4]
 LDCM0024  KB05 Ramos C68(1.27)  LDD2185  [4]
 LDCM0506  Nucleophilic fragment 16a MDA-MB-231 C68(0.99)  LDD2099  [1]
 LDCM0514  Nucleophilic fragment 20a MDA-MB-231 C68(1.00)  LDD2107  [1]
 LDCM0516  Nucleophilic fragment 21a MDA-MB-231 C68(0.84)  LDD2109  [1]
 LDCM0526  Nucleophilic fragment 26a MDA-MB-231 C68(3.16)  LDD2119  [1]
 LDCM0527  Nucleophilic fragment 26b MDA-MB-231 C68(0.67)  LDD2120  [1]
 LDCM0530  Nucleophilic fragment 28a MDA-MB-231 C68(0.97)  LDD2123  [1]
 LDCM0532  Nucleophilic fragment 29a MDA-MB-231 C68(0.87)  LDD2125  [1]
 LDCM0534  Nucleophilic fragment 30a MDA-MB-231 C68(1.05)  LDD2127  [1]
 LDCM0546  Nucleophilic fragment 40 MDA-MB-231 C68(0.77)  LDD2140  [1]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Transcription factor
Click To Hide/Show 9 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Basic leucine zipper transcriptional factor ATF-like 3 (BATF3) BZIP family Q9NR55
Endoplasmic reticulum membrane sensor NFE2L1 (NFE2L1) BZIP family Q14494
Nuclear factor erythroid 2-related factor 2 (NFE2L2) BZIP family Q16236
Nuclear factor erythroid 2-related factor 3 (NFE2L3) BZIP family Q9Y4A8
Transcription regulator protein BACH1 (BACH1) BZIP family O14867
Transcription regulator protein BACH2 (BACH2) BZIP family Q9BYV9
Transcription factor MafF (MAFF) BZIP family Q9ULX9
Transcription factor MafG (MAFG) BZIP family O15525
Nuclear factor interleukin-3-regulated protein (NFIL3) BZIP family Q16649

References

1 Nucleophilic covalent ligand discovery for the cysteine redoxome. Nat Chem Biol. 2023 Nov;19(11):1309-1319. doi: 10.1038/s41589-023-01330-5. Epub 2023 May 29.
Mass spectrometry data entry: PXD039908 , PXD029761
2 Enhancing Cysteine Chemoproteomic Coverage through Systematic Assessment of Click Chemistry Product Fragmentation. Anal Chem. 2022 Mar 8;94(9):3800-3810. doi: 10.1021/acs.analchem.1c04402. Epub 2022 Feb 23.
Mass spectrometry data entry: PXD028853
3 Chemoproteomic capture of RNA binding activity in living cells. Nat Commun. 2023 Oct 7;14(1):6282. doi: 10.1038/s41467-023-41844-z.
Mass spectrometry data entry: PXD044625
4 Site-specific quantitative cysteine profiling with data-independent acquisition-based mass spectrometry. Methods Enzymol. 2023;679:295-322. doi: 10.1016/bs.mie.2022.07.037. Epub 2022 Sep 7.
Mass spectrometry data entry: PXD027578