Details of the Target
General Information of Target
| Target ID | LDTP00584 | |||||
|---|---|---|---|---|---|---|
| Target Name | Neurosecretory protein VGF (VGF) | |||||
| Gene Name | VGF | |||||
| Gene ID | 7425 | |||||
| Synonyms |
Neurosecretory protein VGF [Cleaved into: Neuroendocrine regulatory peptide-1; NERP-1; Neuroendocrine regulatory peptide-2; NERP-2; VGF-derived peptide TLQP-21; VGF-derived peptide TLQP-62; Antimicrobial peptide VGF[554-577]]
|
|||||
| 3D Structure | ||||||
| Sequence |
MKALRLSASALFCLLLINGLGAAPPGRPEAQPPPLSSEHKEPVAGDAVPGPKDGSAPEVR
GARNSEPQDEGELFQGVDPRALAAVLLQALDRPASPPAPSGSQQGPEEEAAEALLTETVR SQTHSLPAPESPEPAAPPRPQTPENGPEASDPSEELEALASLLQELRDFSPSSAKRQQET AAAETETRTHTLTRVNLESPGPERVWRASWGEFQARVPERAPLPPPAPSQFQARMPDSGP LPETHKFGEGVSSPKTHLGEALAPLSKAYQGVAAPFPKARRPESALLGGSEAGERLLQQG LAQVEAGRRQAEATRQAAAQEERLADLASDLLLQYLLQGGARQRGLGGRGLQEAAEERES AREEEEAEQERRGGEERVGEEDEEAAEAEAEAEEAERARQNALLFAEEEDGEAGAEDKRS QEETPGHRRKEAEGTEEGGEEEDDEEMDPQTIDSLIELSTKLHLPADDVVSIIEEVEEKR KRKKNAPPEPVPPPRAAPAPTHVRSPQPPPPAPAPARDELPDWNEVLPPWDREEDEVYPP GPYHPFPNYIRPRTLQPPSALRRRHYHHALPPSRHYPGREAQARRAQEEAEAEERRLQEQ EELENYIEHVLLRRP |
|||||
| Target Bioclass |
Other
|
|||||
| Subcellular location |
Secreted
|
|||||
| Function |
[Neurosecretory protein VGF]: Secreted polyprotein that is packaged and proteolytically processed by prohormone convertases PCSK1 and PCSK2 in a cell-type-specific manner. VGF and peptides derived from its processing play many roles in neurogenesis and neuroplasticity associated with learning, memory, depression and chronic pain.; [Neuroendocrine regulatory peptide-1]: Plays a role in the control of body fluid homeostasis by regulating vasopressin release. Suppresses presynaptic glutamatergic neurons connected to vasopressin neurons.; [Neuroendocrine regulatory peptide-2]: Plays a role in the control of body fluid homeostasis by regulating vasopressin release. Activates GABAergic interneurons which are inhibitory neurons of the nervous system and thereby suppresses presynaptic glutamatergic neurons. Stimulates also feeding behavior in an orexin-dependent manner in the hypothalamus. Functions as a positive regulator for the activation of orexin neurons resulting in elevated gastric acid secretion and gastric emptying.; [VGF-derived peptide TLQP-21]: Secreted multifunctional neuropeptide that binds to different cell receptors and thereby plays multiple physiological roles including modulation of energy expenditure, pain, response to stress, gastric regulation, glucose homeostasis as well as lipolysis. Activates the G-protein-coupled receptor C3AR1 via a folding-upon-binding mechanism leading to enhanced lipolysis in adipocytes. Interacts with C1QBP receptor in macrophages and microglia causing increased levels of intracellular calcium and hypersensitivity.; [VGF-derived peptide TLQP-62]: Plays a role in the regulation of memory formation and depression-related behaviors potentially by influencing synaptic plasticity and neurogenesis. Induces acute and transient activation of the NTRK2/TRKB receptor and subsequent CREB phosphorylation. Induces also insulin secretion in insulinoma cells by increasing intracellular calcium mobilization.; [Antimicrobial peptide VGF[554-577]]: Has bactericidal activity against M. luteus, and antifungal activity against P. Pastoris.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
FBPP2 Probe Info |
![]() |
31.34 | LDD0318 | [2] | |
|
Jackson_1 Probe Info |
![]() |
20.00 | LDD0121 | [3] | |
Competitor(s) Related to This Target
References


