Details of the Target

General Information of Target

Target ID LDTP00348
Target Name Phospholipid phosphatase 1 (PLPP1)
Gene Name PLPP1
Gene ID 8611
Synonyms
LPP1; PPAP2A; Phospholipid phosphatase 1; EC 3.1.3.-; EC 3.1.3.106; EC 3.1.3.4; EC 3.6.1.75; Lipid phosphate phosphohydrolase 1; PAP2-alpha; Phosphatidate phosphohydrolase type 2a; Phosphatidic acid phosphatase 2a; PAP-2a; PAP2a
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MFDKTRLPYVALDVLCVLLAGLPFAILTSRHTPFQRGVFCNDESIKYPYKEDTIPYALLG
GIIIPFSIIVIILGETLSVYCNLLHSNSFIRNNYIATIYKAIGTFLFGAAASQSLTDIAK
YSIGRLRPHFLDVCDPDWSKINCSDGYIEYYICRGNAERVKEGRLSFYSGHSSFSMYCML
FVALYLQARMKGDWARLLRPTLQFGLVAVSIYVGLSRVSDYKHHWSDVLTGLIQGALVAI
LVAVYVSDFFKERTSFKERKEEDSHTTLHETPTTGNHYPSNHQP
Target Bioclass
Enzyme
Family
PA-phosphatase related phosphoesterase family
Subcellular location
Cell membrane
Function
Magnesium-independent phospholipid phosphatase of the plasma membrane that catalyzes the dephosphorylation of a variety of glycerolipid and sphingolipid phosphate esters including phosphatidate/PA, lysophosphatidate/LPA, diacylglycerol pyrophosphate/DGPP, sphingosine 1-phosphate/S1P and ceramide 1-phosphate/C1P. Also acts on N-oleoyl ethanolamine phosphate/N-(9Z-octadecenoyl)-ethanolamine phosphate, a potential physiological compound. Through its extracellular phosphatase activity allows both the hydrolysis and the cellular uptake of these bioactive lipid mediators from the milieu, regulating signal transduction in different cellular processes. It is for instance essential for the extracellular hydrolysis of S1P and subsequent conversion into intracellular S1P. Involved in the regulation of inflammation, platelets activation, cell proliferation and migration among other processes. May also have an intracellular activity to regulate phospholipid-mediated signaling pathways.
Uniprot ID
O14494
Ensemble ID
ENST00000264775.9
HGNC ID
HGNC:9228

Target Site Mutations in Different Cell Lines

Cell line Mutation details Probe for labeling this protein in this cell
HCT15 SNV: p.S255Y .
HDQP1 SNV: p.R127Q .
KYSE30 SNV: p.A109T .
LN18 SNV: p.A96V .
SW948 SNV: p.I90T .

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 3 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
DBIA
 Probe Info  		C40(1.90)  LDD3412  [1]
BTD
 Probe Info  		C40(1.16)  LDD2113  [2]
Acrolein
 Probe Info  		N.A.  LDD0227  [3]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0284  AC24 HEK-293T C40(0.94)  LDD1523  [4]
 LDCM0293  AC32 HEK-293T C40(0.88)  LDD1532  [4]
 LDCM0302  AC40 HEK-293T C40(1.02)  LDD1541  [4]
 LDCM0310  AC48 HEK-293T C40(0.92)  LDD1549  [4]
 LDCM0319  AC56 HEK-293T C40(1.04)  LDD1558  [4]
 LDCM0328  AC64 HEK-293T C40(1.02)  LDD1567  [4]
 LDCM0345  AC8 HEK-293T C40(1.01)  LDD1569  [4]
 LDCM0520  AKOS000195272 MDA-MB-231 C40(1.16)  LDD2113  [2]
 LDCM0275  AKOS034007705 HEK-293T C40(1.08)  LDD1514  [4]
 LDCM0390  CL12 HEK-293T C40(1.12)  LDD1594  [4]
 LDCM0412  CL24 HEK-293T C40(1.20)  LDD1616  [4]
 LDCM0425  CL36 HEK-293T C40(1.27)  LDD1629  [4]
 LDCM0438  CL48 HEK-293T C40(1.01)  LDD1642  [4]
 LDCM0452  CL60 HEK-293T C40(1.23)  LDD1655  [4]
 LDCM0465  CL72 HEK-293T C40(1.16)  LDD1668  [4]
 LDCM0478  CL84 HEK-293T C40(1.07)  LDD1681  [4]
 LDCM0491  CL96 HEK-293T C40(1.01)  LDD1694  [4]
 LDCM0022  KB02 HT-1197 C40(1.36)  LDD2369  [1]
 LDCM0023  KB03 KMCH-1 C40(1.87)  LDD2835  [1]
 LDCM0024  KB05 RT-112 C40(1.90)  LDD3412  [1]
 LDCM0109  NEM HeLa N.A.  LDD0227  [3]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 2 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
cAMP-dependent protein kinase catalytic subunit alpha (PRKACA) AGC Ser/Thr protein kinase family P17612
Calcium/calmodulin-dependent protein kinase type II subunit alpha (CAMK2A) CAMK Ser/Thr protein kinase family Q9UQM7
Transporter and channel
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Amyloid-beta precursor protein (APP) APP family P05067
Transcription factor
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Homeobox protein TGIF1 (TGIF1) TALE/TGIF homeobox family Q15583
GPCR
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
G-protein coupled receptor 42 (GPR42) G-protein coupled receptor 1 family O15529
Other
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Serine-rich single-pass membrane protein 1 (SSMEM1) . Q8WWF3

References

1 DrugMap: A quantitative pan-cancer analysis of cysteine ligandability. Cell. 2024 May 9;187(10):2536-2556.e30. doi: 10.1016/j.cell.2024.03.027. Epub 2024 Apr 22.
Mass spectrometry data entry: PXD047840
2 Nucleophilic covalent ligand discovery for the cysteine redoxome. Nat Chem Biol. 2023 Nov;19(11):1309-1319. doi: 10.1038/s41589-023-01330-5. Epub 2023 May 29.
Mass spectrometry data entry: PXD039908 , PXD029761
3 ACR-Based Probe for the Quantitative Profiling of Histidine Reactivity in the Human Proteome. J Am Chem Soc. 2023 Mar 8;145(9):5252-5260. doi: 10.1021/jacs.2c12653. Epub 2023 Feb 27.
4 Accelerating multiplexed profiling of protein-ligand interactions: High-throughput plate-based reactive cysteine profiling with minimal input. Cell Chem Biol. 2024 Mar 21;31(3):565-576.e4. doi: 10.1016/j.chembiol.2023.11.015. Epub 2023 Dec 19.
Mass spectrometry data entry: PXD044402