Details of the Target
General Information of Target
| Target ID | LDTP00210 | |||||
|---|---|---|---|---|---|---|
| Target Name | Ras-related protein Rab-27B (RAB27B) | |||||
| Gene Name | RAB27B | |||||
| Gene ID | 5874 | |||||
| Synonyms |
Ras-related protein Rab-27B; EC 3.6.5.2; C25KG |
|||||
| 3D Structure | ||||||
| Sequence |
MTDGDYDYLIKLLALGDSGVGKTTFLYRYTDNKFNPKFITTVGIDFREKRVVYNAQGPNG
SSGKAFKVHLQLWDTAGQERFRSLTTAFFRDAMGFLLMFDLTSQQSFLNVRNWMSQLQAN AYCENPDIVLIGNKADLPDQREVNERQARELADKYGIPYFETSAATGQNVEKAVETLLDL IMKRMEQCVEKTQIPDTVNGGNSGNLDGEKPPEKKCIC |
|||||
| Target Bioclass |
Enzyme
|
|||||
| Family |
Small GTPase superfamily, Rab family
|
|||||
| Subcellular location |
Membrane
|
|||||
| Function |
Small GTPase which cycles between active GTP-bound and inactive GDP-bound states. In its active state, binds to a variety of effector proteins to regulate homeostasis of late endocytic pathway, including endosomal positioning, maturation and secretion. Plays a role in NTRK2/TRKB axonal anterograde transport by facilitating the association of NTRK2/TRKB with KLC1. May be involved in targeting uroplakins to urothelial apical membranes.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
![]() |
C123(1.62) | LDD3314 | [1] | |
|
HPAP Probe Info |
![]() |
3.07 | LDD0064 | [2] | |
|
IA-alkyne Probe Info |
![]() |
N.A. | LDD0162 | [3] | |
|
ATP probe Probe Info |
![]() |
N.A. | LDD0035 | [4] | |
|
NAIA_4 Probe Info |
![]() |
N.A. | LDD2226 | [5] | |
|
NAIA_5 Probe Info |
![]() |
N.A. | LDD2224 | [5] | |
|
IPM Probe Info |
![]() |
N.A. | LDD0147 | [6] | |
|
TFBX Probe Info |
![]() |
N.A. | LDD0148 | [6] | |
Competitor(s) Related to This Target
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Enzyme
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Deoxyhypusine synthase (DHPS) | Deoxyhypusine synthase family | P49366 | |||
Transporter and channel
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Caveolin-1 (CAV1) | Caveolin family | Q03135 | |||
Other
References








