Details of the Target
General Information of Target
| Target ID | LDTP20191 | |||||
|---|---|---|---|---|---|---|
| Target Name | Uncharacterized protein DNAH10OS (DNAH10OS) | |||||
| Gene Name | DNAH10OS | |||||
| Synonyms |
Uncharacterized protein DNAH10OS |
|||||
| 3D Structure | ||||||
| Sequence |
MLPSTMFLVHLPLSTNRLHCLRNTSLESCLCSFVHLNHPLHISDPVILISLHEAVRFSFA
FSFPRGTLSIAYCLMSSVSTSSEAIMSTELLANYCHSSLHVCICISSFPNETGNHDSFPG AVVSISDQPTDQCKLAAKELPLRNLLECRFFDCMGEEDLINLGVIGTER |
|||||
| Target Bioclass |
Other
|
|||||
| Uniprot ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
IA-alkyne Probe Info |
![]() |
C97(1.25) | LDD2182 | [1] | |
Competitor(s) Related to This Target
| Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
|---|---|---|---|---|---|
| LDCM0625 | F8 | Ramos | C97(1.73) | LDD2187 | [1] |
| LDCM0572 | Fragment10 | Ramos | C97(1.67) | LDD2189 | [1] |
| LDCM0574 | Fragment12 | Ramos | C97(0.99) | LDD2191 | [1] |
| LDCM0575 | Fragment13 | Ramos | C97(0.48) | LDD2192 | [1] |
| LDCM0576 | Fragment14 | Ramos | C97(0.92) | LDD2193 | [1] |
| LDCM0579 | Fragment20 | Ramos | C97(1.77) | LDD2194 | [1] |
| LDCM0580 | Fragment21 | Ramos | C97(0.61) | LDD2195 | [1] |
| LDCM0582 | Fragment23 | Ramos | C97(0.50) | LDD2196 | [1] |
| LDCM0578 | Fragment27 | Ramos | C97(0.50) | LDD2197 | [1] |
| LDCM0586 | Fragment28 | Ramos | C97(0.19) | LDD2198 | [1] |
| LDCM0588 | Fragment30 | Ramos | C97(0.43) | LDD2199 | [1] |
| LDCM0589 | Fragment31 | Ramos | C97(0.44) | LDD2200 | [1] |
| LDCM0590 | Fragment32 | Ramos | C97(1.92) | LDD2201 | [1] |
| LDCM0468 | Fragment33 | Ramos | C97(0.52) | LDD2202 | [1] |
| LDCM0596 | Fragment38 | Ramos | C97(0.51) | LDD2203 | [1] |
| LDCM0566 | Fragment4 | Ramos | C97(0.78) | LDD2184 | [1] |
| LDCM0610 | Fragment52 | Ramos | C97(0.49) | LDD2204 | [1] |
| LDCM0614 | Fragment56 | Ramos | C97(0.67) | LDD2205 | [1] |
| LDCM0569 | Fragment7 | Ramos | C97(1.01) | LDD2186 | [1] |
| LDCM0571 | Fragment9 | Ramos | C97(3.25) | LDD2188 | [1] |
| LDCM0022 | KB02 | Ramos | C97(1.25) | LDD2182 | [1] |
| LDCM0023 | KB03 | Ramos | C97(1.07) | LDD2183 | [1] |
| LDCM0024 | KB05 | Ramos | C97(1.34) | LDD2185 | [1] |

