Details of the Target | Chem(Pro)²

General Information of Target

Target ID	LDTP19941
Target Name	Putative gamma-taxilin 2 (TXLNGY)
Gene Name	TXLNGY
Synonyms	CYorf15A; CYorf15B; TXLNG2P; Putative gamma-taxilin 2; Gamma-taxilin 2 pseudogene; Taxilin gamma pseudogene, Y-linked
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Sequence	MKTQDDGVLPPYDVNQLLGWDLNLSLFLGLCLMLLLAGSCLPSPGITGLSHGSNREDR
Target Bioclass	Other
Family	Taxilin family
Uniprot ID	Q9BZA5
HGNC ID	HGNC:18473

Probe(s) Labeling This Target

ABPP Probe

Click To Hide/Show 1 Probe Related to This Target

Probe name		Structure	Binding Site(Ratio)	Interaction ID	Ref
AHL-Pu-1 Probe Info			C119(2.62)	LDD0171	[1]

Competitor(s) Related to This Target

Competitor ID	Name	Cell line	Binding Site(Ratio)	Interaction ID	Ref
LDCM0026	4SU-RNA+native RNA	DM93	C119(2.62)	LDD0171	[1]

References

1	Chemoproteomic capture of RNA binding activity in living cells. Nat Commun. 2023 Oct 7;14(1):6282. doi: 10.1038/s41467-023-41844-z. Mass spectrometry data entry: PXD044625