Details of the Target
General Information of Target
| Target ID | LDTP19569 | |||||
|---|---|---|---|---|---|---|
| Target Name | Uncharacterized protein FLJ45252 | |||||
| Synonyms |
Uncharacterized protein FLJ45252 |
|||||
| 3D Structure | ||||||
| Sequence |
MEWGPGSDWSRGEAAGVDRGKAGLGLGGRPPPQPPREERAQQLLDAVEQRQRQLLDTIAA
CEEMLRQLGRRRPEPAGGGNVSAKPGAPPQPAVSARGGFPKDAGDGAAEP |
|||||
| Target Bioclass |
Other
|
|||||
| Uniprot ID | ||||||
| ChEMBL ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
STPyne Probe Info |
![]() |
K350(10.00) | LDD0277 | [1] | |
|
DA-P3 Probe Info |
![]() |
9.21 | LDD0180 | [2] | |
|
IA-alkyne Probe Info |
![]() |
N.A. | LDD0165 | [3] | |
|
IPM Probe Info |
![]() |
N.A. | LDD0147 | [4] | |
|
Phosphinate-6 Probe Info |
![]() |
N.A. | LDD0018 | [5] | |
|
NAIA_5 Probe Info |
![]() |
N.A. | LDD2223 | [6] | |
Competitor(s) Related to This Target
References






