Details of the Target
General Information of Target
| Target ID | LDTP19557 | |||||
|---|---|---|---|---|---|---|
| Target Name | Leucine-rich repeat-containing protein 74B (LRRC74B) | |||||
| Gene Name | LRRC74B | |||||
| Gene ID | 400891 | |||||
| Synonyms |
Leucine-rich repeat-containing protein 74B |
|||||
| 3D Structure | ||||||
| Sequence |
MRNMIPQDNENPPQQGEANQNDSVAFEDVAVNFTPDEWALLDPSQKNLYREVMQETLRNL
ASIEVLWKRDSLKVKVISMEKF |
|||||
| Target Bioclass |
Other
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
W1 Probe Info |
![]() |
H88(2.14) | LDD0239 | [1] | |
Competitor(s) Related to This Target

