Details of the Target
General Information of Target
| Target ID | LDTP18983 | |||||
|---|---|---|---|---|---|---|
| Target Name | Thiosulfate sulfurtransferase/rhodanese-like domain-containing protein 3 (TSTD3) | |||||
| Gene Name | TSTD3 | |||||
| Gene ID | 100130890 | |||||
| Synonyms |
Thiosulfate sulfurtransferase/rhodanese-like domain-containing protein 3; Rhodanese domain-containing protein 3 |
|||||
| 3D Structure | ||||||
| Sequence |
MNVCCSSHPVNEKVWKPSSRKWSSKVWSMDEFDLQTACYWFMTRCQKEAGKFGTHRGKPM
CFVRSLLRVQLLPRTFPANSFVISFFPSLIYPLQVYQLHFESSDKQRAMQFVTEG |
|||||
| Target Bioclass |
Enzyme
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
CY4 Probe Info |
![]() |
N.A. | LDD0247 | [1] | |

