Details of the Target
General Information of Target
| Target ID | LDTP18877 | |||||
|---|---|---|---|---|---|---|
| Target Name | Putative rhophilin-2-like protein RHPN2P1 (RHPN2P1) | |||||
| Gene Name | RHPN2P1 | |||||
| Synonyms |
Putative rhophilin-2-like protein RHPN2P1; Rhophilin-2 pseudogene 1 |
|||||
| 3D Structure | ||||||
| Sequence |
MAPLPGAELVRRPLQLYRYLLRCCQQLPTKGIQQHYKHAVRQSFRVHSDEDNPERIQQII
KRAIEDADWIMNKYKKQN |
|||||
| Target Bioclass |
Other
|
|||||
| Uniprot ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
IPM Probe Info |
![]() |
N.A. | LDD0241 | [1] | |
|
DBIA Probe Info |
![]() |
C359(18.40) | LDD0204 | [2] | |
|
IA-alkyne Probe Info |
![]() |
N.A. | LDD0166 | [3] | |
|
WYneN Probe Info |
![]() |
N.A. | LDD0021 | [4] | |
|
NAIA_5 Probe Info |
![]() |
C296(0.00); C554(0.00) | LDD2223 | [5] | |
Competitor(s) Related to This Target
References





