Details of the Target
General Information of Target
| Target ID | LDTP18779 | |||||
|---|---|---|---|---|---|---|
| Target Name | Putative nuclear envelope pore membrane protein POM 121B (POM121B) | |||||
| Gene Name | POM121B | |||||
| Synonyms |
Putative nuclear envelope pore membrane protein POM 121B |
|||||
| 3D Structure | ||||||
| Sequence |
MAGAELGAALEQRLGALAIHTEVVEHPEVFTVEEMMPHIQHLKGAHSKNLFLKDKKKKNY
WLVTVLHDRQINLNELAKQLGVGSGNLRFADETAMLEKLKVGQGCATPLALFCDGGDVKF VLDSAFLEGGHEKVYFHPMTNAATMGLSPEDFLTFVKMTGHDPIILNFD |
|||||
| Target Bioclass |
Transporter and channel
|
|||||
| Family |
POM121 family
|
|||||
| Subcellular location |
Nucleus, nuclear pore complex
|
|||||
| Function | Putative component of the nuclear pore complex (NPC). The repeat-containing domain may be involved in anchoring components of the pore complex to the pore membrane. | |||||
| Uniprot ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
AHL-Pu-1 Probe Info |
 |
C197(2.07) | LDD0168 | [1] | |
Competitor(s) Related to This Target