Details of the Target
General Information of Target
| Target ID | LDTP18538 | |||||
|---|---|---|---|---|---|---|
| Target Name | Meteorin (METRN) | |||||
| Gene Name | METRN | |||||
| Gene ID | 79006 | |||||
| Synonyms |
C16orf23; Meteorin |
|||||
| 3D Structure | ||||||
| Sequence |
MVIRVFIASSSGFVAIKKKQQDVVRFLEANKIEFEEVDITMSEEQRQWMYKNVPPEKKPT
QGNPLPPQIFNGDRYCGDYDSFFESKESNTVFSFLGLKPRLASKAEP |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
Meteorin family
|
|||||
| Subcellular location |
Secreted
|
|||||
| Function |
Involved in both glial cell differentiation and axonal network formation during neurogenesis. Promotes astrocyte differentiation and transforms cerebellar astrocytes into radial glia. Also induces axonal extension in small and intermediate neurons of sensory ganglia by activating nearby satellite glia.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
TPP-AC Probe Info |
 |
N.A. | LDD0427 | [1] | |