Details of the Target

General Information of Target

Target ID	LDTP18125
Target Name	Claudin-23 (CLDN23)
Gene Name	CLDN23
Gene ID	137075
Synonyms	Claudin-23
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Sequence	MGSCVSRDLFTSAHKNCPMPQGADPLNPDLPSGRTPTVAPDCVIGKDKQMDFCWDPWQRC FQTTNGYLSDSRSRPGNYNVAALATSSLVGVVQSIKDHITKPTAMARGRVAHLIEWKGWS AQPAGWELSPAEDEHYCCLPDELREARFAAGVAEQFAITEATLSAWSSLDEEELHPENSP QGIVQLQDLESIYLQDSLPSGPSQDDSLQAFSSPSPSPDSCPSPEEPPSTAGIPQPPSPE LQHRRRLPGAQGPEGGTHPPGSLPSMDSGSLWEEDEVFYN
Target Bioclass	Transporter and channel
Family	Claudin family
Subcellular location	Cell junction, tight junction
Function	Plays a major role in tight junction-specific obliteration of the intercellular space, through calcium-independent cell-adhesion activity.
Uniprot ID	Q96B33
Ensemble ID	ENST00000519106.2
HGNC ID	HGNC:17591

Probe(s) Labeling This Target

ABPP Probe

Click To Hide/Show 2 Probe Related to This Target

Probe name		Structure	Binding Site(Ratio)	Interaction ID	Ref
IA-alkyne Probe Info			C63(1.54)	LDD2187	[1]
MPP-AC Probe Info			N.A.	LDD0428	[2]

Competitor(s) Related to This Target

Competitor ID	Name	Cell line	Binding Site(Ratio)	Interaction ID	Ref
LDCM0625	F8	Ramos	C63(1.54)	LDD2187	[1]
LDCM0573	Fragment11	Ramos	C63(15.85)	LDD2190	[1]
LDCM0576	Fragment14	Ramos	C63(1.88)	LDD2193	[1]
LDCM0586	Fragment28	Ramos	C63(1.35)	LDD2198	[1]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Other

Click To Hide/Show 1 Protein(s) Interacting with This Target

Protein name				Family	Uniprot ID
Sushi domain-containing protein 3 (SUSD3)				.	Q96L08

References

1	Site-specific quantitative cysteine profiling with data-independent acquisition-based mass spectrometry. Methods Enzymol. 2023;679:295-322. doi: 10.1016/bs.mie.2022.07.037. Epub 2022 Sep 7. Mass spectrometry data entry: PXD027578
2	Differently Tagged Probes for Protein Profiling of Mitochondria. Chembiochem. 2019 May 2;20(9):1155-1160. doi: 10.1002/cbic.201800735. Epub 2019 Mar 26.